• Gene id: 116534

Gene Summary

• Gene Symbol: MRGPRE   Gene   UCSC   Ensembl
• Aliases: GPR167, MGRF, MRGE
• Gene name: MAS related GPR family member E
• Alternate names: mas-related G-protein coupled receptor member E, G-protein coupled receptor 167, MAS-related GPR, member E, Mas-related G protein-coupled receptor F, mas-related G protein-coupled MRGE,
• Gene location: 11p15.4 (3232416: 3225029)     Exons: 2     NC_000011.10
• OMIM: 607233

Protein Summary

• Protein general information: Q86SM8  
  • Name: Mas related G protein coupled receptor member E (G protein coupled receptor 167)
  • Length: 312  
  • Mass: 34286
• Sequence:

  MMEPREAGQHVGAANGAQEDVAFNLIILSLTEGLGLGGLLGNGAVLWLLSSNVYRNPFAIYLLDVACADLIFLGC
  HMVAIVPDLLQGRLDFPGFVQTSLATLRFFCYIVGLSLLAAVSVEQCLAALFPAWYSCRRPRHLTTCVCALTWAL
  CLLLHLLLSGACTQFFGEPSRHLCRTLWLVAAVLLALLCCTMCGASLMLLLRVERGPQRPPPRGFPGLILLTVLL
  FLFCGLPFGIYWLSRNLLWYIPHYFYHFSFLMAAVHCAAKPVVYFCLGSAQGRRLPLRLVLQRALGDEAELGAVR
  ETSRRGLVDIAA

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR026230  IPR026234  
  • Prosite: PS50262
  • STRING: ENSP00000374482
• Other Databases: GeneCards:  MRGPRE  Malacards:  MRGPRE

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007186	G protein-coupled receptor signaling pathway	IBA	biological process
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq