• Gene id: 116449

Gene Summary

• Gene Symbol: CLNK   Gene   UCSC   Ensembl
• Aliases: MIST
• Gene name: cytokine dependent hematopoietic cell linker
• Alternate names: cytokine-dependent hematopoietic cell linker, mast cell immunoreceptor signal transducer,
• Gene location: 4p16.1 (10734852: 10486394)     Exons: 21     NC_000004.12
• Gene summary(Entrez): MIST is a member of the SLP76 family of adaptors (see LCP2, MIM 601603; BLNK, MIM 604515). MIST plays a role in the regulation of immunoreceptor signaling, including PLC-gamma (PLCG1; MIM 172420)-mediated B cell antigen receptor (BCR) signaling and FC-eps
• OMIM: 609429

Protein Summary

• Protein general information: Q7Z7G1  
  • Name: Cytokine dependent hematopoietic cell linker (Mast cell immunoreceptor signal transducer)
  • Length: 428  
  • Mass: 49554
• Sequence:

  MNRQGNRKTTKEGSNDLKFQNFSLPKNRSWPRINSATGQYQRMNKPLLDWERNFAAVLDGAKGHSDDDYDDPELR
  MEETWQSIKILPARPIKESEYADTHYFKVAMDTPLPLDTRTSISIGQPTWNTQTRLERVDKPISKDVRSQNIKGD
  ASVRKNKIPLPPPRPLITLPKKYQPLPPEPESSRPPLSQRHTFPEVQRMPSQISLRDLSEVLEAEKVPHNQRKPE
  STHLLENQNTQEIPLAISSSSFTTSNHSVQNRDHRGGMQPCSPQRCQPPASCSPHENILPYKYTSWRPPFPKRSD
  RKDVQHNEWYIGEYSRQAVEEAFMKENKDGSFLVRDCSTKSKEEPYVLAVFYENKVYNVKIRFLERNQQFALGTG
  LRGDEKFDSVEDIIEHYKNFPIILIDGKDKTGVHRKQCHLTQPLPLTRHLLPL

• Structural information:
  • Protein Domains: (309..41-)
    (/note="SH2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00191"-)
  • Interpro: IPR000980  IPR036860  
  • Prosite: PS50001
  • STRING: ENSP00000226951
• Other Databases: GeneCards:  CLNK  Malacards:  CLNK

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IBA	biological process
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032991	protein-containing complex	IEA	cellular component
GO:0032815	negative regulation of natural killer cell activation	IEA	biological process
GO:0010941	regulation of cell death	IEA	biological process
GO:0002729	positive regulation of natural killer cell cytokine production	IEA	biological process
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0007169	transmembrane receptor protein tyrosine kinase signaling pathway	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IMP	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray