• Gene id: 116444

Gene Summary

• Gene Symbol: GRIN3B   Gene   UCSC   Ensembl
• Aliases: GluN3B, NR3B
• Gene name: glutamate ionotropic receptor NMDA type subunit 3B
• Alternate names: glutamate receptor ionotropic, NMDA 3B, N-methyl-D-aspartate receptor subtype 3B, NMDA receptor subunit 3B, NMDA type glutamate receptor subunit NR3B, NMDAR3B, glutamate [NMDA] receptor subunit 3B, glutamate receptor, ionotropic, N-methyl-D-aspartate 3B,
• Gene location: 19p13.3 (1000418: 1009747)     Exons: 9     NC_000019.10
• Gene summary(Entrez): The protein encoded by this gene is a subunit of an N-methyl-D-aspartate (NMDA) receptor. The encoded protein is found primarily in motor neurons, where it forms a heterotetramer with GRIN1 to create an excitatory glycine receptor. Variations in this gene
• OMIM: 607232

Protein Summary

• Protein general information: O60391  
  • Name: Glutamate receptor ionotropic, NMDA 3B (GluN3B) (N methyl D aspartate receptor subtype 3B) (NMDAR3B) (NR3B)
  • Length: 1043  
  • Mass: 112992
• Sequence:

  MEFVRALWLGLALALGPGSAGGHPQPCGVLARLGGSVRLGALLPRAPLARARARAALARAALAPRLPHNLSLELV
  VAAPPARDPASLTRGLCQALVPPGVAALLAFPEARPELLQLHFLAAATETPVLSLLRREARAPLGAPNPFHLQLH
  WASPLETLLDVLVAVLQAHAWEDVGLALCRTQDPGGLVALWTSRAGRPPQLVLDLSRRDTGDAGLRARLAPMAAP
  VGGEAPVPAAVLLGCDIARARRVLEAVPPGPHWLLGTPLPPKALPTAGLPPGLLALGEVARPPLEAAIHDIVQLV
  ARALGSAAQVQPKRALLPAPVNCGDLQPAGPESPGRFLARFLANTSFQGRTGPVWVTGSSQVHMSRHFKVWSLRR
  DPRGAPAWATVGSWRDGQLDLEPGGASARPPPPQGAQVWPKLRVVTLLEHPFVFARDPDEDGQCPAGQLCLDPGT
  NDSATLDALFAALANGSAPRALRKCCYGYCIDLLERLAEDTPFDFELYLVGDGKYGALRDGRWTGLVGDLLAGRA
  HMAVTSFSINSARSQVVDFTSPFFSTSLGIMVRARDTASPIGAFMWPLHWSTWLGVFAALHLTALFLTVYEWRSP
  YGLTPRGRNRSTVFSYSSALNLCYAILFRRTVSSKTPKCPTGRLLMNLWAIFCLLVLSSYTANLAAVMVGDKTFE
  ELSGIHDPKLHHPAQGFRFGTVWESSAEAYIKKSFPDMHAHMRRHSAPTTPRGVAMLTSDPPKLNAFIMDKSLLD
  YEVSIDADCKLLTVGKPFAIEGYGIGLPQNSPLTSNLSEFISRYKSSGFIDLLHDKWYKMVPCGKRVFAVTETLQ
  MSIYHFAGLFVLLCLGLGSALLSSLGEHAFFRLALPRIRKGSRLQYWLHTSQKIHRALNTEPPEGSKEETAEAEP
  SGPEVEQQQQQQDQPTAPEGWKRARRAVDKERRVRFLLEPAVVVAPEADAEAEAAPREGPVWLCSYGRPPAARPT
  GAPQPGELQELERRIEVARERLRQALVRRGQLLAQLGDSARHRPRRLLQARAAPAEAPPHSGRPGSQE

• Structural information:
  • Interpro: IPR019594  IPR001508  IPR001320  IPR028082  
  • STRING: ENSP00000234389
• Other Databases: GeneCards:  GRIN3B  Malacards:  GRIN3B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1904315	transmitter-gated ion channel activity involved in regulation of postsynaptic membrane potential	IBA	molecular function
GO:0098839	postsynaptic density membrane	IBA	cellular component
GO:0038023	signaling receptor activity	IBA	molecular function
GO:0035249	synaptic transmission, glutamatergic	IBA	biological process
GO:0015276	ligand-gated ion channel activity	IBA	molecular function
GO:0004972	NMDA glutamate receptor activity	IBA	contributes to
GO:0050804	modulation of chemical synaptic transmission	IBA	biological process
GO:0045211	postsynaptic membrane	IBA	cellular component
GO:0035235	ionotropic glutamate receptor signaling pathway	IBA	biological process
GO:0008066	glutamate receptor activity	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0004970	ionotropic glutamate receptor activity	IEA	molecular function
GO:0015276	ligand-gated ion channel activity	IEA	molecular function
GO:0038023	signaling receptor activity	IEA	molecular function
GO:0005216	ion channel activity	IEA	molecular function
GO:0006811	ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005262	calcium channel activity	IEA	molecular function
GO:0017146	NMDA selective glutamate receptor complex	IEA	cellular component
GO:0051205	protein insertion into membrane	IEA	biological process
GO:0051924	regulation of calcium ion transport	IEA	biological process
GO:0043025	neuronal cell body	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0070588	calcium ion transmembrane transport	IEA	biological process
GO:0070588	calcium ion transmembrane transport	IEA	biological process
GO:0034220	ion transmembrane transport	IEA	biological process
GO:0034220	ion transmembrane transport	IEA	biological process
GO:0034220	ion transmembrane transport	IEA	biological process
GO:0034220	ion transmembrane transport	IEA	biological process
GO:0098655	cation transmembrane transport	IEA	biological process
GO:0060078	regulation of postsynaptic membrane potential	IEA	biological process
GO:0051924	regulation of calcium ion transport	ISS	biological process
GO:0042165	neurotransmitter binding	ISS	molecular function
GO:0005262	calcium channel activity	ISS	contributes to
GO:0043025	neuronal cell body	ISS	cellular component
GO:0030594	neurotransmitter receptor activity	ISS	molecular function
GO:0051205	protein insertion into membrane	ISS	biological process
GO:0017146	NMDA selective glutamate receptor complex	NAS	cellular component
GO:0017146	NMDA selective glutamate receptor complex	ISS	cellular component
GO:0016594	glycine binding	ISS	molecular function
GO:0005261	cation channel activity	ISS	molecular function
GO:0035235	ionotropic glutamate receptor signaling pathway	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction
hsa04024	cAMP signaling pathway
hsa05034	Alcoholism
hsa05017	Spinocerebellar ataxia
hsa04724	Glutamatergic synapse
hsa05031	Amphetamine addiction
hsa05030	Cocaine addiction
hsa05033	Nicotine addiction

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq