• Gene id: 116254

Gene Summary

• Gene Symbol: GINM1   Gene   UCSC   Ensembl
• Aliases: C6orf72
• Gene name: glycoprotein integral membrane 1
• Alternate names: glycoprotein integral membrane protein 1,
• Gene location: 6q25.1 (149566374: 149591747)     Exons: 8     NC_000006.12

Protein Summary

• Protein general information: Q9NU53  
  • Name: Glycoprotein integral membrane protein 1
  • Length: 330  
  • Mass: 36840
• Sequence:

  MEGAPPGSLALRLLLFVALPASGWLTTGAPEPPPLSGAPQDGIRINVTTLKDDGDISKQQVVLNITYESGQVYVN
  DLPVNSGVTRISCQTLIVKNENLENLEEKEYFGIVSVRILVHEWPMTSGSSLQLIVIQEEVVEIDGKQVQQKDVT
  EIDILVKNRGVLRHSNYTLPLEESMLYSISRDSDILFTLPNLSKKESVSSLQTTSQYLIRNVETTVDEDVLPGKL
  PETPLRAEPPSSYKVMCQWMEKFRKDLCRFWSNVFPVFFQFLNIMVVGITGAAVVITILKVFFPVSEYKGILQLD
  KVDVIPVTAINLYPDGPEKRAENLEDKTCI

• Structural information:
  • Interpro: IPR042319  
  • STRING: ENSP00000356389
• Other Databases: GeneCards:  GINM1  Malacards:  GINM1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray