• Gene id: 116159

Gene Summary

• Gene Symbol: CYYR1   Gene   UCSC   Ensembl
• Aliases: C21orf95
• Gene name: cysteine and tyrosine rich 1
• Alternate names: cysteine and tyrosine-rich protein 1, cysteine and tyrosine-rich protein 1 isoform 1,2,2bis,3,4, cysteine and tyrosine-rich protein 1 isoform 1,2,3,4b, cysteine and tyrosine-rich protein 1 isoform 1,2,3b, cysteine and tyrosine-rich protein 1 isoform 1,2,4, cys,
• Gene location: 21q21.3 (26573285: 26466215)     Exons: 8     NC_000021.9
• OMIM: 176394

Protein Summary

• Protein general information: Q96J86  
  • Name: Cysteine and tyrosine rich protein 1 (Proline rich domain containing protein)
  • Length: 154  
  • Mass: 16626
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MDAPRLPVRPGVLLPKLVLLFVYADDCLAQCGKDCKSYCCDGTTPYCCSYYAYIGNILSGTAIAGIVFGIVFIMG
  VIAGIAICICMCMKNHRATRVGILRTTHINTVSSYPGPPPYGHDHEMEYCADLPPPYSPTPQGPAQRSPPPPYPG
  NARK

• Structural information:
  • Interpro: IPR022640  
  • STRING: ENSP00000299340
• Other Databases: GeneCards:  CYYR1  Malacards:  CYYR1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0008150	biological_process	ND	biological process
GO:0003674	molecular_function	ND	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881