• Gene id: 116143

Gene Summary

• Gene Symbol: WDR92   Gene   UCSC   Ensembl
• Gene name: WD repeat domain 92
• Alternate names: WD repeat-containing protein 92, WD repeat-containing protein Monad, monad, testicular secretory protein Li 67,
• Gene location: 2p14 (68157526: 68129804)     Exons: 8     NC_000002.12
• Gene summary(Entrez): This gene encodes a protein with two WD40 repeat domains thought to be involved in an apoptosis via activation of caspase-3. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2012]
• OMIM: 610729

Protein Summary

• Protein general information: Q96MX6  
  • Name: WD repeat containing protein 92 (WD repeat containing protein Monad)
  • Length: 357  
  • Mass: 39740
  • Tissue specificity: Widely expressed with the highest expression in testis. {ECO
• Sequence:

  MSAFEKPQIIAHIQKGFNYTVFDCKWVPCSAKFVTMGNFARGTGVIQLYEIQHGDLKLLREIEKAKPIKCGTFGA
  TSLQQRYLATGDFGGNLHIWNLEAPEMPVYSVKGHKEIINAIDGIGGLGIGEGAPEIVTGSRDGTVKVWDPRQKD
  DPVANMEPVQGENKRDCWTVAFGNAYNQEERVVCAGYDNGDIKLFDLRNMALRWETNIKNGVCSLEFDRKDISMN
  KLVATSLEGKFHVFDMRTQHPTKGFASVSEKAHKSTVWQVRHLPQNRELFLTAGGAGGLHLWKYEYPIQRSKKDS
  EGIEMGVAGSVSLLQNVTLSTQPISSLDWSPDKRGLCVCSSFDQTVRVLIVTKLNKI

• Structural information:
  • Interpro: IPR015943  IPR001680  IPR017986  IPR036322  
  • Prosite: PS50082 PS50294
  • PDB: 3I2N
  • PDBsum: 3I2N
  • STRING: ENSP00000477980
• Other Databases: GeneCards:  WDR92  Malacards:  WDR92

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043130	ubiquitin binding	IBA	molecular function
GO:0006915	apoptotic process	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881