• Gene id: 116092

Gene Summary

• Gene Symbol: DNTTIP1   Gene   UCSC   Ensembl
• Aliases: C20orf167, Tdif1, dJ447F3.4
• Gene name: deoxynucleotidyltransferase terminal interacting protein 1
• Alternate names: deoxynucleotidyltransferase terminal-interacting protein 1, TdT binding protein, tdT-interacting factor 1, terminal deoxynucleotidyltransferase-interacting factor 1,
• Gene location: 20q13.12 (136866335: 136862118)     Exons: 5     NC_000009.12
• Gene summary(Entrez): DNTTIP1 binds DNA and enhances the activity of terminal deoxynucleotidyltransferase (TDT, or DNTT; MIM 187410), a DNA polymerase that catalyzes the polymerization of DNA in the absence of a DNA template (Yamashita et al., 2001 [PubMed 11473582]).[supplied
• OMIM: 611388

Protein Summary

• Protein general information: Q9H147  
  • Name: Deoxynucleotidyltransferase terminal interacting protein 1 (Terminal deoxynucleotidyltransferase interacting factor 1) (TdIF1) (TdT interacting factor 1)
  • Length: 329  
  • Mass: 37013
• Sequence:

  MGATGDAEQPRGPSGAERGGLELGDAGAAGQLVLTNPWNIMIKHRQVQRRGRRSQMTTSFTDPAISMDLLRAVLQ
  PSINEEIQTVFNKYMKFFQKAALNVRDNVGEEVDAEQLIQEACRSCLEQAKLLFSDGEKVIPRLTHELPGIKRGR
  QAEEECAHRGSPLPKKRKGRPPGHILSSDRAAAGMVWKPKSCEPIRREGPKWDPARLNESTTFVLGSRANKALGM
  GGTRGRIYIKHPHLFKYAADPQDKHWLAEQHHMRATGGKMAYLLIEEDIRDLAASDDYRGCLDLKLEELKSFVLP
  SWMVEKMRKYMETLRTENEHRAVEAPPQT

• Structural information:
  • Interpro: IPR041384  IPR026064  
  • PDB: 2MWI 4D6K
  • PDBsum: 2MWI 4D6K
  • STRING: ENSP00000361705
• Other Databases: GeneCards:  DNTTIP1  Malacards:  DNTTIP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031491	nucleosome binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0003677	DNA binding	IBA	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0000118	histone deacetylase complex	IDA	cellular component
GO:0031491	nucleosome binding	IDA	molecular function
GO:0003677	DNA binding	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0003677	DNA binding	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881