• Gene id: 115752

Gene Summary

• Gene Symbol: DIS3L   Gene   UCSC   Ensembl
• Aliases: DIS3L1
• Gene name: DIS3 like exosome 3'-5' exoribonuclease
• Alternate names: DIS3-like exonuclease 1, DIS3 mitotic control homolog-like,
• Gene location: 15q22.31 (66293308: 66333897)     Exons: 21     NC_000015.10
• Gene summary(Entrez): The cytoplasmic RNA exosome complex degrades unstable mRNAs and is involved in the regular turnover of other mRNAs. The protein encoded by this gene contains 3'-5' exoribonuclease activity and is a catalytic component of this complex. [provided by RefSeq,
• OMIM: 618796

Protein Summary

• Protein general information: Q8TF46  
  • Name: DIS3 like exonuclease 1 (EC 3.1.13. )
  • Length: 1054  
  • Mass: 120787
• Sequence:

  MLQKREKVLLLRTFQGRTLRIVREHYLRPCVPCHSPLCPQPAACSHDGKLLSSDVTHYVIPDWKVVQDYLEILEF
  PELKGIIFMQTACQAVQHQRGRRQYNKLRNLLKDARHDCILFANEFQQCCYLPRERGESMEKWQTRSIYNAAVWY
  YHHCQDRMPIVMVTEDEEAIQQYGSETEGVFVITFKNYLDNFWPDLKAAHELCDSILQSRRERENESQESHGKEY
  PEHLPLEVLEAGIKSGRYIQGILNVNKHRAQIEAFVRLQGASSKDSDLVSDILIHGMKARNRSIHGDVVVVELLP
  KNEWKGRTVALCENDCDDKASGESPSEPMPTGRVVGILQKNWRDYVVTFPSKEEVQSQGKNAQKILVTPWDYRIP
  KIRISTQQAETLQDFRVVVRIDSWESTSVYPNGHFVRVLGRIGDLEGEIATILVENSISVIPFSEAQMCEMPVNT
  PESPWKVSPEEEQKRKDLRKSHLVFSIDPKGCEDVDDTLSVRTLNNGNLELGVHIADVTHFVAPNSYIDIEARTR
  ATTYYLADRRYDMLPSVLSADLCSLLGGVDRYAVSIMWELDKASYEIKKVWYGRTIIRSAYKLFYEAAQELLDGN
  LSVVDDIPEFKDLDEKSRQAKLEELVWAIGKLTDIARHVRAKRDGCGALELEGVEVCVQLDDKKNIHDLIPKQPL
  EVHETVAECMILANHWVAKKIWESFPHQALLRQHPPPHQEFFSELRECAKAKGFFIDTRSNKTLADSLDNANDPH
  DPIVNRLLRSMATQAMSNALYFSTGSCAEEEFHHYGLALDKYTHFTSPIRRYSDIVVHRLLMAAISKDKKMEIKG
  NLFSNKDLEELCRHINNRNQAAQHSQKQSTELFQCMYFKDKDPATEERCISDGVIYSIRTNGVLLFIPRFGIKGA
  AYLKNKDGLVISCGPDSCSEWKPGSLQRFQNKITSTTTDGESVTFHLFDHVTVRISIQASRCHSDTIRLEIISNK
  PYKIPNTELIHQSSPLLKSELVKEVTKSVEEAQLAQEVKVNIIQEEYQEYRQTKGRSLYTLLEEIRDLALLDVSN
  NYGI

• Structural information:
  • Interpro: IPR041505  IPR031192  IPR012340  IPR001900  IPR022966   IPR033771  IPR033770  
  • Prosite: PS01175
  • STRING: ENSP00000321711
• Other Databases: GeneCards:  DIS3L  Malacards:  DIS3L

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000175	3'-5'-exoribonuclease activity	IBA	molecular function
GO:0016075	rRNA catabolic process	IBA	biological process
GO:0000177	cytoplasmic exosome (RNase complex)	IBA	cellular component
GO:0000178	exosome (RNase complex)	IBA	cellular component
GO:0019899	enzyme binding	IPI	molecular function
GO:0016075	rRNA catabolic process	IMP	biological process
GO:0090503	RNA phosphodiester bond hydrolysis, exonucleolytic	IEA	biological process
GO:0000175	3'-5'-exoribonuclease activity	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0004540	ribonuclease activity	IEA	molecular function
GO:0016075	rRNA catabolic process	IEA	biological process
GO:0000178	exosome (RNase complex)	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0004518	nuclease activity	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0004527	exonuclease activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0016075	rRNA catabolic process	IDA	biological process
GO:0000175	3'-5'-exoribonuclease activity	IDA	molecular function
GO:0000177	cytoplasmic exosome (RNase complex)	IDA	cellular component
GO:0000177	cytoplasmic exosome (RNase complex)	IDA	cellular component
GO:0000175	3'-5'-exoribonuclease activity	IMP	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03018	RNA degradation

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq