• Gene id: 115560

Gene Summary

• Gene Symbol: ZNF501   Gene   UCSC   Ensembl
• Aliases: ZNF, ZNF52
• Gene name: zinc finger protein 501
• Alternate names: zinc finger protein 501, zinc finger protein 52,
• Gene location: 3p21.31 (44729605: 44737082)     Exons: 3     NC_000003.12
• OMIM: 603769

Protein Summary

• Protein general information: Q96CX3  
  • Name: Zinc finger protein 501 (Zinc finger protein 52)
  • Length: 271  
  • Mass: 31179
• Sequence:

  MNSSQISLRMKHGRVNMQKKPSKCSECGKFFTQRSSLTQHQRIHRGEKPYVCSECGSCFRKQSNLTQHLRIHTGE
  KPYKCNECEKAFQTKAILVQHLRIHTGEKPYKCNECGKAFCQSPSLIKHQRIHTGEKPYKCTECGKAFSQSICLT
  RHQRSHSGDKPFKCNECGKAFNQSACLMQHQRIHSGEKPYTCTECGKAFTQNSSLVEHERTHTGEKLYKCSECEK
  TFRKQAHLSEHYRIHTGEKPYECVGCGKSFRHSSALLRHQRLHAGE

• Structural information:
  • Interpro: IPR036236  IPR013087  
  • Prosite: PS00028 PS50157
  • STRING: ENSP00000482632
• Other Databases: GeneCards:  ZNF501  Malacards:  ZNF501

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000122	negative regulation of transcription by RNA polymerase II	IBA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0000976	transcription regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0003700	DNA-binding transcription factor activity	IBA	molecular function
GO:0005654	nucleoplasm	IBA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0007030	Golgi organization	IMP	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881