• Gene id: 115557

Gene Summary

• Gene Symbol: ARHGEF25   Gene   UCSC   Ensembl
• Aliases: GEFT, p63RhoGEF
• Gene name: Rho guanine nucleotide exchange factor 25
• Alternate names: rho guanine nucleotide exchange factor 25, RAC/CDC42 exchange factor, Rho guanine nucleotide exchange factor (GEF) 25, RhoA/RAC/CDC42 exchange factor, guanine nucleotide exchange factor GEFT, rac/Cdc42/Rho exchange factor GEFT, rhoA/Rac/Cdc42 guanine nucleotide,
• Gene location: 12q13.3 (57610115: 57617244)     Exons: 18     NC_000012.12
• Gene summary(Entrez): Rho GTPases alternate between an inactive GDP-bound state and an active GTP-bound state, and GEFs facilitate GDP/GTP exchange. This gene encodes a guanine nucleotide exchange factor (GEF) which interacts with Rho GTPases involved in contraction of vascula
• OMIM: 614445

Protein Summary

• Protein general information: Q86VW2  
  • Name: Rho guanine nucleotide exchange factor 25 (Guanine nucleotide exchange factor GEFT) (Rac/Cdc42/Rho exchange factor GEFT) (RhoA/Rac/Cdc42 guanine nucleotide exchange factor GEFT) (p63RhoGEF)
  • Length: 580  
  • Mass: 63843
  • Tissue specificity: Isoform 1 and isoform 2 are highly expressed in excitable tissues, such as brain, heart and muscle. Also detected in kidney and liver. {ECO
• Sequence:

  MRGGHKGGRCACPRVIRKVLAKCGCCFARGGRESYSIAGSEGSISASAASGLAAPSGPSSGLSSGPCSPGPPGPV
  SGLRRWLDHSKHCLSVETEADSGQAGPYENWMLEPALATGEELPELTLLTTLLEGPGDKTQPPEEETLSQAPESE
  EEQKKKALERSMYVLSELVETEKMYVDDLGQIVEGYMATMAAQGVPESLRGRDRIVFGNIQQIYEWHRDYFLQEL
  QRCLKDPDWLAQLFIKHERRLHMYVVYCQNKPKSEHVVSEFGDSYFEELRQQLGHRLQLNDLLIKPVQRIMKYQL
  LLKDFLKYYNRAGMDTADLEQAVEVMCFVPKRCNDMMTLGRLRGFEGKLTAQGKLLGQDTFWVTEPEAGGLLSSR
  GRERRVFLFEQIIIFSEALGGGVRGGTQPGYVYKNSIKVSCLGLEGNLQGDPCRFALTSRGPEGGIQRYVLQAAD
  PAISQAWIKHVAQILESQRDFLNALQSPIEYQRRESQTNSLGRPRGPGVGSPGRIQLGDQAQGSTHTPINGSLPS
  LLLSPKGEVARALLPLDKQALGDIPQAPHDSPPVSPTPKTPPCQARLAKLDEDEL

• Structural information:
  • Protein Domains: (160..33-)
    (/note="DH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00062-)
    (348..46-)
    (/note="PH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00145"-)
  • Interpro: IPR030738  IPR035899  IPR000219  IPR011993  IPR001849  
  • Prosite: PS50010 PS50003
  • CDD: cd00160
  • PDB: 2RGN
  • PDBsum: 2RGN
  • STRING: ENSP00000335560
• Other Databases: GeneCards:  ARHGEF25  Malacards:  ARHGEF25

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030016	myofibril	ISS	cellular component
GO:0005886	plasma membrane	ISS	cellular component
GO:0005085	guanyl-nucleotide exchange factor activity	IEA	molecular function
GO:0005089	Rho guanyl-nucleotide exchange factor activity	IEA	molecular function
GO:0035023	regulation of Rho protein signal transduction	IEA	biological process
GO:0005085	guanyl-nucleotide exchange factor activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0030017	sarcomere	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05130	Pathogenic Escherichia coli infection

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881