• Gene id: 114905

Gene Summary

• Gene Symbol: C1QTNF7   Gene   UCSC   Ensembl
• Aliases: CTRP7, ZACRP7
• Gene name: C1q and TNF related 7
• Alternate names: complement C1q tumor necrosis factor-related protein 7, C1q and tumor necrosis factor related protein 7, complement-c1q tumor necrosis factor-related protein 7,
• Gene location: 4p15.32 (15339817: 15446168)     Exons: 14     NC_000004.12

Protein Summary

• Protein general information: Q9BXJ2  
  • Name: Complement C1q tumor necrosis factor related protein 7
  • Length: 289  
  • Mass: 30683
• Sequence:

  MFVLLYVTSFAICASGQPRGNQLKGENYSPRYICSIPGLPGPPGPPGANGSPGPHGRIGLPGRDGRDGRKGEKGE
  KGTAGLRGKTGPLGLAGEKGDQGETGKKGPIGPEGEKGEVGPIGPPGPKGDRGEQGDPGLPGVCRCGSIVLKSAF
  SVGITTSYPEERLPIIFNKVLFNEGEHYNPATGKFICAFPGIYYFSYDITLANKHLAIGLVHNGQYRIKTFDANT
  GNHDVASGSTVIYLQPEDEVWLEIFFTDQNGLFSDPGWADSLFSGFLLYVDTDYLDSISEDDEL

• Structural information:
  • Protein Domains: (38..13-)
    (/note="Collagen-like-)
    (143..27-)
    (/note="C1q-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00368"-)
  • Interpro: IPR001073  IPR008160  IPR008983  
  • Prosite: PS50871
  • STRING: ENSP00000295297
• Other Databases: GeneCards:  C1QTNF7  Malacards:  C1QTNF7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005576	extracellular region	IEA	cellular component
GO:0005581	collagen trimer	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)