• Gene id: 114884

Gene Summary

• Gene Symbol: OSBPL10   Gene   UCSC   Ensembl
• Aliases: ORP10, OSBP9
• Gene name: oxysterol binding protein like 10
• Alternate names: oxysterol-binding protein-related protein 10, ORP-10, OSBP-related protein 10,
• Gene location: 3p23 (31981849: 31660824)     Exons: 15     NC_000003.12
• Gene summary(Entrez): This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Like most members, the encoded protein contains an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like stero
• OMIM: 606738

Protein Summary

• Protein general information: Q9BXB5  
  • Name: Oxysterol binding protein related protein 10 (ORP 10) (OSBP related protein 10)
  • Length: 764  
  • Mass: 83970
• Sequence:

  MERAVQGTDGGGGSNSSSRSSSRATSAGSSPSCSLAGRGVSSRSAAAGLGGGGSRSSPGSVAASPSGGGGRRREP
  ALEGVLSKYTNLLQGWQNRYFVLDFEAGILQYFVNEQSKHQKPRGVLSLSGAIVSLSDEAPHMLVVYSANGEMFK
  LRAADAKEKQFWVTQLRACAKYHMEMNSKSAPSSRSRSLTLLPHGTPNSASPCSQRHLSVGAPGVVTITHHKSPA
  AARRAKSQYSGQLHEVREMMNQVEGQQKNLVHAIESLPGSGPLTALDQDLLLLKATSAATLSCLGECLNLLQQSV
  HQAGQPSQKPGASENILGWHGSKSHSTEQLKNGTLGSLPSASANITWAILPNSAEDEQTSQPEPEPNSGSELVLS
  EDEKSDNEDKEETELGVMEDQRSIILHLISQLKLGMDLTKVVLPTFILEKRSLLEMYADFMAHPDLLLAITAGAT
  PEERVICFVEYYLTAFHEGRKGALAKKPYNPIIGETFHCSWEVPKDRVKPKRTASRSPASCHEHPMADDPSKSYK
  LRFVAEQVSHHPPISCFYCECEEKRLCVNTHVWTKSKFMGMSVGVSMIGEGVLRLLEHGEEYVFTLPSAYARSIL
  TIPWVELGGKVSINCAKTGYSATVIFHTKPFYGGKVHRVTAEVKHNPTNTIVCKAHGEWNGTLEFTYNNGETKVI
  DTTTLPVYPKKIRPLEKQGPMESRNLWREVTRYLRLGDIDAATEQKRHLEEKQRVEERKRENLRTPWKPKYFIQE
  GDGWVYFNPLWKAH

• Structural information:
  • Protein Domains: (74..17-)
    (/note="PH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00145"-)
  • Interpro: IPR037239  IPR000648  IPR018494  IPR011993  IPR041680   IPR001849  
  • Prosite: PS01013 PS50003
  • STRING: ENSP00000379804
• Other Databases: GeneCards:  OSBPL10  Malacards:  OSBPL10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	IBA	cellular component
GO:0008289	lipid binding	IBA	molecular function
GO:0032934	sterol binding	IBA	molecular function
GO:0043231	intracellular membrane-bounded organelle	IBA	cellular component
GO:0015248	sterol transporter activity	IBA	molecular function
GO:0015485	cholesterol binding	IBA	molecular function
GO:0016020	membrane	IBA	cellular component
GO:0001786	phosphatidylserine binding	IDA	molecular function
GO:0008289	lipid binding	IEA	molecular function
GO:0006629	lipid metabolic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0006869	lipid transport	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0036150	phosphatidylserine acyl-chain remodeling	TAS	biological process
GO:0005548	phospholipid transporter activity	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0015485	cholesterol binding	IDA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0015914	phospholipid transport	IEA	biological process
GO:0015918	sterol transport	IEA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq