• Gene id: 114804

Gene Summary

• Gene Symbol: RNF157   Gene   UCSC   Ensembl
• Gene name: ring finger protein 157
• Alternate names: E3 ubiquitin ligase RNF157, RING-type E3 ubiquitin transferase RNF157,
• Gene location: 17q25.1 (76240492: 76142455)     Exons: 22     NC_000017.11
• OMIM: 0

Protein Summary

• Protein general information: Q96PX1  
  • Name: E3 ubiquitin ligase RNF157 (EC 2.3.2.27) (RING finger protein 157) (RING type E3 ubiquitin transferase RNF157)
  • Length: 679  
  • Mass: 73579
• Sequence:

  MGALTSRQHAGVEEVDIPSNSVYRYPPKSGSYFASHFIMGGEKFDSTHPEGYLFGENSDLNFLGNRPVVFPYAAP
  PPQEPVKTLRSLVNIRKDTLRLVKCAEEVKSPGEEASKAKVHYNVEFTFDTDARVAITIYYQATEEFQNGIASYI
  PKDNSLQSETVQYKRGVCQQFCLPSHTVDPSEWAEEELGFDLDREVYPLVVHAVVDEGDEYFGHCHVLLGTFEKH
  TDGTFCVKPLKQKQVVDGVSYLLQEIYGIENKYNTQDSKVAEDEVSDNSAECVVCLSDVRDTLILPCRHLCLCNT
  CADTLRYQANNCPICRLPFRALLQIRAMRKKLGPLSPTSFNPIISSQTSDSEEHPSSENIPPGYEVVSLLEALNG
  PLTPSPAVPPLHVLGDGHLSGMLPSYGSDGHLPPVRTISPLDRLSDSSSQGLKLKKSLSKSTSQNSSVLHEEEDE
  HSCSESETQLSQRPSVQHLGEECGVTPESENLTLSSSGAIDQSSCTGTPLSSTISSPEGPASSSLAQSVMSMASS
  QISTDTVSSMSGSYIAPGTEEEGEALSSPQPASRAPSEEGEGLPAESPDSNFAGLPAGEQDAEGNDVIEEEDGSP
  TQEGQRTCAFLGMECDNNNDFDIASVKALDNKLCSEVCLPGAWQADDNAVSRNAQRRRLSSSSLEDSETRPCVWG
  PLAV

• Structural information:
  • Interpro: IPR001841  IPR013083  
  • Prosite: PS50089
  • STRING: ENSP00000269391
• Other Databases: GeneCards:  RNF157  Malacards:  RNF157

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0016567	protein ubiquitination	IBA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0061630	ubiquitin protein ligase activity	IEA	molecular function
GO:0044297	cell body	IEA	cellular component
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:1903861	positive regulation of dendrite extension	IEA	biological process
GO:0051865	protein autoubiquitination	IEA	biological process
GO:0016567	protein ubiquitination	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0044297	cell body	ISS	cellular component
GO:0061630	ubiquitin protein ligase activity	ISS	molecular function
GO:1903861	positive regulation of dendrite extension	ISS	biological process
GO:0051865	protein autoubiquitination	ISS	biological process
GO:0016567	protein ubiquitination	ISS	biological process
GO:0043066	negative regulation of apoptotic process	ISS	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)