• Gene id: 114798

Gene Summary

• Gene Symbol: SLITRK1   Gene   UCSC   Ensembl
• Aliases: LRRC12, TTM
• Gene name: SLIT and NTRK like family member 1
• Alternate names: SLIT and NTRK-like protein 1, leucine-rich repeat-containing protein 12, slit and trk like gene 1,
• Gene location: 13q31.1 (83882473: 83877204)     Exons: 2     NC_000013.11
• Gene summary(Entrez): This gene encodes a member of the SLITRK protein family. Members of this family are integral membrane proteins that are characterized by two N-terminal leucine-rich repeat (LRR) domains and a C-terminal region that shares homology with trk neurotrophin re
• OMIM: 609678

Protein Summary

• Protein general information: Q96PX8  
  • Name: SLIT and NTRK like protein 1 (Leucine rich repeat containing protein 12)
  • Length: 696  
  • Mass: 77735
  • Tissue specificity: Expressed predominantly in the frontal lobe of the cerebral cortex of the brain. Also expressed in some astrocytic brain tumors such as astrocytomas, oligodendrogliomas, glioblastomas, gangliogliomas and primitive neuroectodermal tumor
• Sequence:

  MLLWILLLETSLCFAAGNVTGDVCKEKICSCNEIEGDLHVDCEKKGFTSLQRFTAPTSQFYHLFLHGNSLTRLFP
  NEFANFYNAVSLHMENNGLHEIVPGAFLGLQLVKRLHINNNKIKSFRKQTFLGLDDLEYLQADFNLLRDIDPGAF
  QDLNKLEVLILNDNLISTLPANVFQYVPITHLDLRGNRLKTLPYEEVLEQIPGIAEILLEDNPWDCTCDLLSLKE
  WLENIPKNALIGRVVCEAPTRLQGKDLNETTEQDLCPLKNRVDSSLPAPPAQEETFAPGPLPTPFKTNGQEDHAT
  PGSAPNGGTKIPGNWQIKIRPTAAIATGSSRNKPLANSLPCPGGCSCDHIPGSGLKMNCNNRNVSSLADLKPKLS
  NVQELFLRDNKIHSIRKSHFVDYKNLILLDLGNNNIATVENNTFKNLLDLRWLYMDSNYLDTLSREKFAGLQNLE
  YLNVEYNAIQLILPGTFNAMPKLRILILNNNLLRSLPVDVFAGVSLSKLSLHNNYFMYLPVAGVLDQLTSIIQID
  LHGNPWECSCTIVPFKQWAERLGSEVLMSDLKCETPVNFFRKDFMLLSNDEICPQLYARISPTLTSHSKNSTGLA
  ETGTHSNSYLDTSRVSISVLVPGLLLVFVTSAFTVVGMLVFILRNRKRSKRRDANSSASEINSLQTVCDSSYWHN
  GPYNADGAHRVYDCGSHSLSD

• Structural information:
  • Protein Domains: (18..5-)
    (/note="LRRNT-1)
    (212..26-)
    (/note="LRRCT-1)
    (332..37-)
    (/note="LRRNT-2)
    (529..58-)
    (/note="LRRCT-2")
  • Interpro: IPR000483  IPR001611  IPR003591  IPR032675  
  • Prosite: PS51450
  • PDB: 4RCA 4RCW
  • PDBsum: 4RCA 4RCW
  • STRING: ENSP00000366288
• Other Databases: GeneCards:  SLITRK1  Malacards:  SLITRK1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007409	axonogenesis	IBA	biological process
GO:0050772	positive regulation of axonogenesis	IMP	biological process
GO:0045202	synapse	ISS	cellular component
GO:0007416	synapse assembly	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:1905606	regulation of presynapse assembly	IEA	biological process
GO:0007409	axonogenesis	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0042592	homeostatic process	IEA	biological process
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0007399	nervous system development	IEA	biological process
GO:0007409	axonogenesis	IEA	biological process
GO:0030534	adult behavior	IEA	biological process
GO:0035264	multicellular organism growth	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0051965	positive regulation of synapse assembly	IEA	biological process
GO:0099061	integral component of postsynaptic density membrane	IEA	cellular component
GO:0050807	regulation of synapse organization	IEA	biological process
GO:0098982	GABA-ergic synapse	IEA	cellular component
GO:0099061	integral component of postsynaptic density membrane	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0099560	synaptic membrane adhesion	IMP	biological process
GO:1905606	regulation of presynapse assembly	IMP	biological process
GO:1905606	regulation of presynapse assembly	IMP	biological process
GO:1905606	regulation of presynapse assembly	IMP	biological process
GO:1905606	regulation of presynapse assembly	IMP	biological process
GO:1905606	regulation of presynapse assembly	IDA	biological process
GO:1905606	regulation of presynapse assembly	IDA	biological process
GO:0099560	synaptic membrane adhesion	IDA	biological process
GO:0098978	glutamatergic synapse	IMP	cellular component
GO:0098978	glutamatergic synapse	IMP	cellular component
GO:0098978	glutamatergic synapse	IDA	cellular component
GO:0098982	GABA-ergic synapse	IMP	cellular component
GO:0098982	GABA-ergic synapse	IMP	cellular component
GO:0098982	GABA-ergic synapse	IDA	cellular component

Diseases

Associated diseases	References
Tourette syndrome	KEGG:H00862
Trichotillomania	KEGG:H00864
Tourette syndrome	KEGG:H00862
Trichotillomania	KEGG:H00864
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)