• Gene id: 114294

Gene Summary

• Gene Symbol: LACTB   Gene   UCSC   Ensembl
• Aliases: G24, MRPL56
• Gene name: lactamase beta
• Alternate names: serine beta-lactamase-like protein LACTB, mitochondrial, mitochondrial 39S ribosomal protein L56, serine beta-lactamase-like protein, mitochondrial,
• Gene location: 15q22.2 (63121805: 63142061)     Exons: 7     NC_000015.10
• Gene summary(Entrez): This gene encodes a mitochondrially-localized protein that has sequence similarity to prokaryotic beta-lactamases. Many of the residues responsible for beta-lactamase activity are not conserved in this protein, suggesting it may have a different enzymatic
• OMIM: 608440

Protein Summary

• Protein general information: P83111  
  • Name: Serine beta lactamase like protein LACTB, mitochondrial (EC 3.4. . )
  • Length: 547  
  • Mass: 60694
  • Tissue specificity: Expressed predominantly in skeletal muscle. {ECO
• Sequence:

  MYRLMSAVTARAAAPGGLASSCGRRGVHQRAGLPPLGHGWVGGLGLGLGLALGVKLAGGLRGAAPAQSPAAPDPE
  ASPLAEPPQEQSLAPWSPQTPAPPCSRCFARAIESSRDLLHRIKDEVGAPGIVVGVSVDGKEVWSEGLGYADVEN
  RVPCKPETVMRIASISKSLTMVALAKLWEAGKLDLDIPVQHYVPEFPEKEYEGEKVSVTTRLLISHLSGIRHYEK
  DIKKVKEEKAYKALKMMKENVAFEQEKEGKSNEKNDFTKFKTEQENEAKCRNSKPGKKKNDFEQGELYLREKFEN
  SIESLRLFKNDPLFFKPGSQFLYSTFGYTLLAAIVERASGCKYLDYMQKIFHDLDMLTTVQEENEPVIYNRARFY
  VYNKKKRLVNTPYVDNSYKWAGGGFLSTVGDLLKFGNAMLYGYQVGLFKNSNENLLPGYLKPETMVMMWTPVPNT
  EMSWDKEGKYAMAWGVVERKQTYGSCRKQRHYASHTGGAVGASSVLLVLPEELDTETINNKVPPRGIIVSIICNM
  QSVGLNSTALKIALEFDKDRSD

• Structural information:
  • Interpro: IPR001466  IPR012338  
  • STRING: ENSP00000261893
• Other Databases: GeneCards:  LACTB  Malacards:  LACTB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042802	identical protein binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005739	mitochondrion	HDA	cellular component
GO:0019216	regulation of lipid metabolic process	IDA	biological process
GO:0006508	proteolysis	IDA	biological process
GO:0008233	peptidase activity	IDA	molecular function
GO:0005739	mitochondrion	IDA	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006629	lipid metabolic process	IEA	biological process
GO:0005739	mitochondrion	IEA	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R