• Gene id: 113622

Gene Summary

• Gene Symbol: ADPRHL1   Gene   UCSC   Ensembl
• Aliases: ARH2
• Gene name: ADP-ribosylhydrolase like 1
• Alternate names: [Protein ADP-ribosylarginine] hydrolase-like protein 1, ADP-ribosyl-hydrolase, ADP-ribosylarginine hydrolase like 1, ADP-ribosylhydrolase 2,
• Gene location: 13q34 (113453487: 113421944)     Exons: 8     NC_000013.11
• Gene summary(Entrez): ADP-ribosylation is a reversible posttranslational modification used to regulate protein function. ADP-ribosyltransferases (see ART1; MIM 601625) transfer ADP-ribose from NAD+ to the target protein, and ADP-ribosylhydrolases, such as ADPRHL1, reverse the
• OMIM: 118504

Protein Summary

• Protein general information: Q8NDY3  
  • Name: [Protein ADP ribosylarginine] hydrolase like protein 1 (EC 3.2. . ) (ADP ribosylhydrolase 2)
  • Length: 354  
  • Mass: 40105
• Sequence:

  MEKFKAAMLLGSVGDALGYRNVCKENSTVGMKIQEELQRSGGLDHLVLSPGEWPVSDNTIMHIATAEALTTDYWC
  LDDLYREMVRCYVEIVEKLPERRPDPATIEGCAQLKPNNYLLAWHTPFNEKGSGFGAATKAMCIGLRYWKPERLE
  TLIEVSVECGRMTHNHPTGFLGSLCTALFVSFAAQGKPLVQWGRDMLRAVPLAEEYCRKTIRHTAEYQEHWFYFE
  AKWQFYLEERKISKDSENKAIFPDNYDAEEREKTYRKWSSEGRGGRRGHDAPMIAYDALLAAGNSWTELCHRAMF
  HGGESAATGTIAGCLFGLLYGLDLVPKGLYQDLEDKEKLEDLGAALYRLSTEEK

• Structural information:
  • Interpro: IPR012108  IPR005502  IPR036705  
  • STRING: ENSP00000364567
• Other Databases: GeneCards:  ADPRHL1  Malacards:  ADPRHL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000287	magnesium ion binding	IEA	molecular function
GO:0003875	ADP-ribosylarginine hydrolase activity	IEA	molecular function
GO:0051725	protein de-ADP-ribosylation	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq