• Gene id: 113540

Gene Summary

• Gene Symbol: CMTM1   Gene   UCSC   Ensembl
• Aliases: CKLFH, CKLFH1, CKLFSF1
• Gene name: CKLF like MARVEL transmembrane domain containing 1
• Alternate names: CKLF-like MARVEL transmembrane domain-containing protein 1, chemokine-like factor super family 1, chemokine-like factor superfamily 1, chemokine-like factor superfamily member 1, chemokine-like factor-like protein CKLFH1,
• Gene location: 16q21 (66566438: 66579134)     Exons: 4     NC_000016.10
• Gene summary(Entrez): This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies of signaling molecules. The protein encoded by this gene may play an important role in testicular develo
• OMIM: 607884

Protein Summary

• Protein general information: Q8IZ96  
  • Name: CKLF like MARVEL transmembrane domain containing protein 1 (Chemokine like factor superfamily member 1)
  • Length: 169  
  • Mass: 18576
  • Tissue specificity: Highly expressed in testis. {ECO
• Sequence:

  MDPEHAKPESSEAPSGNLKQPETAAALSLILGALACFIITQANESFITITSLEICIVVFFILIYVLTLHHLLTYL
  HWPLLDLTNSIITAVFLSVVAILAMQEKKRRHLLYVGGSLCLTAVIVCCIDAFVVTTKMRTNLKRFLGVEVERKL
  SPAKDAYPETGPDAPQRPA

• Structural information:
  • Protein Domains: (17..13-)
    (/note="MARVEL-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00581"-)
  • Interpro: IPR008253  
  • Prosite: PS51225
  • STRING: ENSP00000368814
• Other Databases: GeneCards:  CMTM1  Malacards:  CMTM1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016021	integral component of membrane	IBA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005125	cytokine activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006935	chemotaxis	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R