• Gene id: 11332

Gene Summary

• Gene Symbol: ACOT7   Gene   UCSC   Ensembl
• Aliases: ACH1, ACT, BACH, CTE-II, LACH, LACH1, hBACH
• Gene name: acyl-CoA thioesterase 7
• Alternate names: cytosolic acyl coenzyme A thioester hydrolase, CTE-IIa, acyl-CoA thioesterase 2, acyl-CoA thioesterase, long chain, brain acyl-CoA hydrolase, long chain acyl-CoA thioester hydrolase,
• Gene location: 1p36.31 (6393765: 6264271)     Exons: 12     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the acyl coenzyme family. The encoded protein hydrolyzes the CoA thioester of palmitoyl-CoA and other long-chain fatty acids. Decreased expression of this gene may be associated with mesial temporal lobe epilepsy. Alternative
• OMIM: 602587

Protein Summary

• Protein general information: O00154  
  • Name: Cytosolic acyl coenzyme A thioester hydrolase (EC 3.1.2.2) (Acyl CoA thioesterase 7) (Brain acyl CoA hydrolase) (BACH) (hBACH) (CTE IIa) (CTE II) (Long chain acyl CoA thioester hydrolase)
  • Length: 380  
  • Mass: 41796
  • Tissue specificity: Isoform 4 is expressed exclusively in brain. {ECO
• Sequence:

  MKLLARALRLCEFGRQASSRRLVAGQGCVGPRRGCCAPVQVVGPRADLPPCGACITGRIMRPDDANVAGNVHGGT
  ILKMIEEAGAIISTRHCNSQNGERCVAALARVERTDFLSPMCIGEVAHVSAEITYTSKHSVEVQVNVMSENILTG
  AKKLTNKATLWYVPLSLKNVDKVLEVPPVVYSRQEQEEEGRKRYEAQKLERMETKWRNGDIVQPVLNPEPNTVSY
  SQSSLIHLVGPSDCTLHGFVHGGVTMKLMDEVAGIVAARHCKTNIVTASVDAINFHDKIRKGCVITISGRMTFTS
  NKSMEIEVLVDADPVVDSSQKRYRAASAFFTYVSLSQEGRSLPVPQLVPETEDEKKRFEEGKGRYLQMKAKRQGH
  AEPQP

• Structural information:
  • Protein Domains: (50..16-)
    1 (/note="HotDog-ACOT-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01106-)
    (224..33-)
    2 (/note="HotDog-ACOT-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01106"-)
  • Interpro: IPR040170  IPR033120  IPR029069  IPR006683  
  • Prosite: PS51770
  • PDB: 2QQ2
  • PDBsum: 2QQ2
  • STRING: ENSP00000367086
• Other Databases: GeneCards:  ACOT7  Malacards:  ACOT7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000062	fatty-acyl-CoA binding	IBA	molecular function
GO:0005654	nucleoplasm	IBA	cellular component
GO:0005829	cytosol	IBA	cellular component
GO:0036042	long-chain fatty acyl-CoA binding	IBA	molecular function
GO:0006631	fatty acid metabolic process	IBA	biological process
GO:0006637	acyl-CoA metabolic process	IBA	biological process
GO:0016290	palmitoyl-CoA hydrolase activity	IBA	molecular function
GO:0047617	acyl-CoA hydrolase activity	IBA	molecular function
GO:1900535	palmitic acid biosynthetic process	IBA	biological process
GO:0016790	thiolester hydrolase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0052689	carboxylic ester hydrolase activity	IEA	molecular function
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016290	palmitoyl-CoA hydrolase activity	IEA	molecular function
GO:0102991	myristoyl-CoA hydrolase activity	IEA	molecular function
GO:0006637	acyl-CoA metabolic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0047617	acyl-CoA hydrolase activity	IEA	molecular function
GO:0016290	palmitoyl-CoA hydrolase activity	IDA	molecular function
GO:0000062	fatty-acyl-CoA binding	IDA	molecular function
GO:0036042	long-chain fatty acyl-CoA binding	IDA	molecular function
GO:0005829	cytosol	IDA	cellular component
GO:0015937	coenzyme A biosynthetic process	IDA	biological process
GO:0036114	medium-chain fatty-acyl-CoA catabolic process	IDA	biological process
GO:0036116	long-chain fatty-acyl-CoA catabolic process	IDA	biological process
GO:0051792	medium-chain fatty acid biosynthetic process	IDA	biological process
GO:1900535	palmitic acid biosynthetic process	IDA	biological process
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01040	Biosynthesis of unsaturated fatty acids
hsa00062	Fatty acid elongation

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray