• Gene id: 11326

Gene Summary

• Gene Symbol: VSIG4   Gene   UCSC   Ensembl
• Aliases: CRIg, Z39IG
• Gene name: V-set and immunoglobulin domain containing 4
• Alternate names: V-set and immunoglobulin domain-containing protein 4, Ig superfamily protein, complement receptor of the immunoglobulin superfamily, protein Z39Ig,
• Gene location: Xq12 (66040124: 66021737)     Exons: 7     NC_000023.11
• Gene summary(Entrez): This gene encodes a v-set and immunoglobulin-domain containing protein that is structurally related to the B7 family of immune regulatory proteins. The encoded protein may be a negative regulator of T-cell responses. This protein is also a receptor for th
• OMIM: 600714

Protein Summary

• Protein general information: Q9Y279  
  • Name: V set and immunoglobulin domain containing protein 4 (Protein Z39Ig)
  • Length: 399  
  • Mass: 43987
  • Tissue specificity: Abundantly expressed in several fetal tissues. In adult tissues, highest expression in lung and placenta. Expressed in resting macrophages. {ECO
• Sequence:

  MGILLGLLLLGHLTVDTYGRPILEVPESVTGPWKGDVNLPCTYDPLQGYTQVLVKWLVQRGSDPVTIFLRDSSGD
  HIQQAKYQGRLHVSHKVPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVSKPTVTTGSG
  YGFTVPQGMRISLQCQARGSPPISYIWYKQQTNNQEPIKVATLSTLLFKPAVIADSGSYFCTAKGQVGSEQHSDI
  VKFVVKDSSKLLKTKTEAPTTMTYPLKATSTVKQSWDWTTDMDGYLGETSAGPGKSLPVFAIILIISLCCMVVFT
  MAYIMLCRKTSQQEHVYEAARAHAREANDSGETMRVAIFASGCSSDEPTSQNLGNNYSDEPCIGQEYQIIAQING
  NYARLLDTVPLDYEFLATEGKSVC

• Structural information:
  • Protein Domains: (21..13-)
    (/note="Ig-like-1)
    (143..22-)
    (/note="Ig-like-2")
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  IPR003598   IPR013106  IPR039939  IPR039944  
  • Prosite: PS50835
  • CDD: cd16089
  • PDB: 2ICC 2ICE 2ICF 5IMK 5IML
  • PDBsum: 2ICC 2ICE 2ICF 5IMK 5IML
  • STRING: ENSP00000363869
• Other Databases: GeneCards:  VSIG4  Malacards:  VSIG4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042130	negative regulation of T cell proliferation	IBA	biological process
GO:0032703	negative regulation of interleukin-2 production	IBA	biological process
GO:0001851	complement component C3b binding	IBA	molecular function
GO:0045957	negative regulation of complement activation, alternative pathway	IBA	biological process
GO:0032703	negative regulation of interleukin-2 production	IEA	biological process
GO:0042130	negative regulation of T cell proliferation	IEA	biological process
GO:0043031	negative regulation of macrophage activation	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0006957	complement activation, alternative pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0001851	complement component C3b binding	IPI	molecular function
GO:0045957	negative regulation of complement activation, alternative pathway	IPI	biological process
GO:0032991	protein-containing complex	IPI	cellular component
GO:0042130	negative regulation of T cell proliferation	IBA	biological process
GO:0032703	negative regulation of interleukin-2 production	IBA	biological process
GO:0001851	complement component C3b binding	IBA	molecular function
GO:0045957	negative regulation of complement activation, alternative pathway	IBA	biological process
GO:0032703	negative regulation of interleukin-2 production	IEA	biological process
GO:0042130	negative regulation of T cell proliferation	IEA	biological process
GO:0043031	negative regulation of macrophage activation	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0006957	complement activation, alternative pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0001851	complement component C3b binding	IPI	molecular function
GO:0045957	negative regulation of complement activation, alternative pathway	IPI	biological process
GO:0032991	protein-containing complex	IPI	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04610	Complement and coagulation cascades

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881