• Gene id: 113220

Gene Summary

• Gene Symbol: KIF12   Gene   UCSC   Ensembl
• Gene name: kinesin family member 12
• Alternate names: kinesin-like protein KIF12,
• Gene location: 9q32 (114100089: 114091622)     Exons: 20     NC_000009.12
• Gene summary(Entrez): This gene encodes a member of the kinesin superfamily of microtubule-associated molecular motors with functions related to the microtubule cytosekelton. Members of this superfamily play important roles in intracellular transport and cell division. A simil
• OMIM: 611278

Protein Summary

• Protein general information: Q96FN5  
  • Name: Kinesin like protein KIF12
  • Length: 646  
  • Mass: 70660
  • Tissue specificity: Expressed in fetal liver, adult brain and pancreatic islet as well as in kidney tumors, uterus cancer and pancreatic cancer. {ECO
• Sequence:

  MEERGSPDGDLARSLEQGPEGPETPIQVVLRVRPMSAAELRRGQQSVLHCSGTRTLQGGPEVAFRFGAVLDAART
  QEDVFRACGVRRLGELALRGFSCTVFTFGQTGSGKTYTLTGPPPQGEGVPVPPSLAGIMQRTFAWLLDRVQHLGA
  PVTLRASYLEIYNEQVRDLLSLGSPRPLPVRWNKTRGFYVEQLRVVEFGSLEALMELLQTGLSRRRNSAHTLNQA
  SSRSHALLTLYISRQTAQQMPSVDPGEPPVGGKLCFVDLAGSEKVAATGSRGELMLEANSINRSLLALGHCISLL
  LDPQRKQSHIPFRDSKLTKLLADSLGGRGVTLMVACVSPSAQCLPETLSTLRYASRAQRVTTRPQAPKSPVAKQP
  QRLETEMLQLQEENRRLQFQLDQMDCKASGLSGARVAWAQRNLYGMLQEFMLENERLRKEKSQLQNSRDLAQNEQ
  RILAQQVHALERRLLSACYHHQQGPGLTPPCPCLMAPAPPCHALPPLYSCPCCHICPLCRVPLAHWACLPGEHHL
  PQVLDPEASGGRPPSARPPPWAPPCSPGSAKCPRERSHSDWTQTRVLAEMLTEEEVVPSAPPLPVRPPKTSPGLR
  GGAGVPNLAQRLEALRDQIGSSLRRGRSQPPCSEGARSPGQVLPPH

• Structural information:
  • Protein Domains: (25..36-)
    (/note="Kinesin-motor)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00283"-)
  • Interpro: IPR028763  IPR027640  IPR019821  IPR001752  IPR036961   IPR027417  
  • Prosite: PS00411 PS50067
  • STRING: ENSP00000363232
• Other Databases: GeneCards:  KIF12  Malacards:  KIF12

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008017	microtubule binding	IBA	molecular function
GO:0007018	microtubule-based movement	IBA	biological process
GO:0005871	kinesin complex	IBA	cellular component
GO:0003777	microtubule motor activity	IBA	molecular function
GO:0016887	ATPase activity	IBA	molecular function
GO:0005874	microtubule	IBA	cellular component
GO:0003777	microtubule motor activity	IEA	molecular function
GO:0007018	microtubule-based movement	IEA	biological process
GO:0008017	microtubule binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005874	microtubule	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0003674	molecular_function	ND	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0008150	biological_process	ND	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Male factor infertility	MIK: 29961538
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
29961538	Male factor infertility			318 (128 couples presenting with OAT (MF) and 118 maternal age-matched control (no MF) subjects undergoing infertility treatment, 72 surplus cryopreserved blastocysts)	Male infertility	RNA-seq