• Gene id: 11318

Gene Summary

• Gene Symbol: GPR182   Gene   UCSC   Ensembl
• Aliases: 7TMR, ADMR, AM-R, AMR, G10D, L1-R, gamrh, hrhAMR
• Gene name: G protein-coupled receptor 182
• Alternate names: G-protein coupled receptor 182, adrenomedullin receptor,
• Gene location: 12q13.3 (56993589: 56998446)     Exons: 3     NC_000012.12
• Gene summary(Entrez): Adrenomedullin is a potent vasodilator peptide that exerts major effects on cardiovascular function. This gene encodes a seven-transmembrane protein that belongs to the family 1 of G-protein coupled receptors. Studies of the rat counterpart suggest that t
• OMIM: 600428

Protein Summary

• Protein general information: O15218  
  • Name: G protein coupled receptor 182
  • Length: 404  
  • Mass: 45323
  • Tissue specificity: Highly expressed in heart, skeletal muscle, immune system, adrenal gland and liver. {ECO
• Sequence:

  MSVKPSWGPGPSEGVTAVPTSDLGEIHNWTELLDLFNHTLSECHVELSQSTKRVVLFALYLAMFVVGLVENLLVI
  CVNWRGSGRAGLMNLYILNMAIADLGIVLSLPVWMLEVTLDYTWLWGSFSCRFTHYFYFVNMYSSIFFLVCLSVD
  RYVTLTSASPSWQRYQHRVRRAMCAGIWVLSAIIPLPEVVHIQLVEGPEPMCLFMAPFETYSTWALAVALSTTIL
  GFLLPFPLITVFNVLTACRLRQPGQPKSRRHCLLLCAYVAVFVMCWLPYHVTLLLLTLHGTHISLHCHLVHLLYF
  FYDVIDCFSMLHCVINPILYNFLSPHFRGRLLNAVVHYLPKDQTKAGTCASSSSCSTQHSIIITKGDSQPAAAAP
  HPEPSLSFQAHHLLPNTSPISPTQPLTPS

• Structural information:
  • Interpro: IPR001350  IPR000276  IPR017452  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000300098
• Other Databases: GeneCards:  GPR182  Malacards:  GPR182

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004888	transmembrane signaling receptor activity	TAS	molecular function
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0016021	integral component of membrane	TAS	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)