• Gene id: 112950

Gene Summary

• Gene Symbol: MED8   Gene   UCSC   Ensembl
• Aliases: ARC32
• Gene name: mediator complex subunit 8
• Alternate names: mediator of RNA polymerase II transcription subunit 8, activator-recruited cofactor 32 kDa component, mediator of RNA polymerase II transcription subunit MED8,
• Gene location: 1p34.2 (48904132: 48921575)     Exons: 8     NC_000012.12
• Gene summary(Entrez): This gene encodes a protein component of the mediator complex, which aids in transcriptional activation through interaction with RNA polymerase II and gene-specific transcription factors. The encoded protein may also function in ubiquitin ligation and pro
• OMIM: 607956

Protein Summary

• Protein general information: Q96G25  
  • Name: Mediator of RNA polymerase II transcription subunit 8 (Activator recruited cofactor 32 kDa component) (ARC32) (Mediator complex subunit 8)
  • Length: 268  
  • Mass: 29080
• Sequence:

  MQREEKQLEASLDALLSQVADLKNSLGSFICKLENEYGRLTWPSVLDSFALLSGQLNTLNKVLKHEKTPLFRNQV
  IIPLVLSPDRDEDLMRQTEGRVPVFSHEVVPDHLRTKPDPEVEEQEKQLTTDAARIGADAAQKQIQSLNKMCSNL
  LEKISKEERESESGGLRPNKQTFNPTDTNALVAAVAFGKGLSNWRPSGSSGPGQAGQPGAGTILAGTSGLQQVQM
  AGAPSQQQPMLSGVQMAQAGQPGKMPSGIKTNIKSASMHPYQR

• Structural information:
  • Interpro: IPR019364  
  • STRING: ENSP00000290663
• Other Databases: GeneCards:  MED8  Malacards:  MED8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070847	core mediator complex	IBA	cellular component
GO:0016592	mediator complex	IBA	cellular component
GO:0006357	regulation of transcription by RNA polymerase II	IBA	biological process
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0003712	transcription coregulator activity	IBA	molecular function
GO:0003712	transcription coregulator activity	IEA	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0016592	mediator complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016592	mediator complex	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray