• Gene id: 11282

Gene Summary

• Gene Symbol: MGAT4B   Gene   UCSC   Ensembl
• Aliases: GNT-IV, GNT-IVB
• Gene name: alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B
• Alternate names: alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B, N-acetylglucosaminyltransferase IVb, N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase IVb, UDP-N-acetylglucosamine: alpha-1,3-D-mannoside beta-1,4-N-acetylglucos,
• Gene location: 5q35.3 (179806976: 179797596)     Exons: 15     NC_000005.10
• Gene summary(Entrez): This gene encodes a key glycosyltransferase that regulates the formation of tri- and multiantennary branching structures in the Golgi apparatus. The encoded protein, in addition to the related isoenzyme A, catalyzes the transfer of N-acetylglucosamine (Gl
• OMIM: 605557

Protein Summary

• Protein general information: Q9UQ53  
  • Name: Alpha 1,3 mannosyl glycoprotein 4 beta N acetylglucosaminyltransferase B (EC 2.4.1.145) (N glycosyl oligosaccharide glycoprotein N acetylglucosaminyltransferase IVb) (GlcNAc T IVb) (GnT IVb) (N acetylglucosaminyltransferase IVb) (UDP N acetylglucosamine:
  • Length: 548  
  • Mass: 63198
  • Tissue specificity: Widely expressed. Strongly overexpressed in pancreatic cancer. {ECO
• Sequence:

  MRLRNGTFLTLLLFCLCAFLSLSWYAALSGQKGDVVDVYQREFLALRDRLHAAEQESLKRSKELNLVLDEIKRAV
  SERQALRDGDGNRTWGRLTEDPRLKPWNGSHRHVLHLPTVFHHLPHLLAKESSLQPAVRVGQGRTGVSVVMGIPS
  VRREVHSYLTDTLHSLISELSPQEKEDSVIVVLIAETDSQYTSAVTENIKALFPTEIHSGLLEVISPSPHFYPDF
  SRLRESFGDPKERVRWRTKQNLDYCFLMMYAQSKGIYYVQLEDDIVAKPNYLSTMKNFALQQPSEDWMILEFSQL
  GFIGKMFKSLDLSLIVEFILMFYRDKPIDWLLDHILWVKVCNPEKDAKHCDRQKANLRIRFKPSLFQHVGTHSSL
  AGKIQKLKDKDFGKQALRKEHVNPPAEVSTSLKTYQHFTLEKAYLREDFFWAFTPAAGDFIRFRFFQPLRLERFF
  FRSGNIEHPEDKLFNTSVEVLPFDNPQSDKEALQEGRTATLRYPRSPDGYLQIGSFYKGVAEGEVDPAFGPLEAL
  RLSIQTDSPVWVILSEIFLKKAD

• Structural information:
  • Interpro: IPR006759  
  • STRING: ENSP00000338487
• Other Databases: GeneCards:  MGAT4B  Malacards:  MGAT4B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	IBA	cellular component
GO:0005795	Golgi stack	IBA	cellular component
GO:0008375	acetylglucosaminyltransferase activity	IBA	molecular function
GO:0006487	protein N-linked glycosylation	IBA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0008454	alpha-1,3-mannosylglycoprotein 4-beta-N-acetylglucosaminyltransferase activity	TAS	molecular function
GO:0006491	N-glycan processing	TAS	biological process
GO:0008454	alpha-1,3-mannosylglycoprotein 4-beta-N-acetylglucosaminyltransferase activity	IEA	molecular function
GO:0000139	Golgi membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0008375	acetylglucosaminyltransferase activity	IEA	molecular function
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0006487	protein N-linked glycosylation	IEA	biological process
GO:0000139	Golgi membrane	IEA	cellular component
GO:0006486	protein glycosylation	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00510	N-Glycan biosynthesis
hsa00513	Various types of N-glycan biosynthesis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq