• Gene id: 112812

Gene Summary

• Gene Symbol: FDX2   Gene   UCSC   Ensembl
• Aliases: FDX1L, MEOAL
• Gene name: ferredoxin 2
• Alternate names: ferredoxin-2, mitochondrial, adrenodoxin-like protein, mitochondrial, ferredoxin 1 like,
• Gene location: 19p13.2 (10316014: 10310044)     Exons: 5     NC_000019.10
• Gene summary(Entrez): This gene encodes a member of the ferredoxin family. The encoded protein contains a 2Fe-2S ferredoxin-type domain and is essential for heme A and Fe/S protein biosynthesis. Mutation in FDX1L gene is associated with mitochondrial muscle myopathy. [provided
• OMIM: 608856

Protein Summary

• Protein general information: Q6P4F2  
  • Name: Ferredoxin 2, mitochondrial (Adrenodoxin like protein) (Ferredoxin 1 like protein)
  • Length: 186  
  • Mass: 19888
  • Tissue specificity: Widely expressed, with highest levels in testis, kidney and brain (at protein level) (PubMed
• Sequence:

  MHVMAASMARGGVSARVLLQAARGTWWNRPGGTSGSGEGVALGTTRKFQATGSRPAGEEDAGGPERPGDVVNVVF
  VDRSGQRIPVSGRVGDNVLHLAQRHGVDLEGACEASLACSTCHVYVSEDHLDLLPPPEEREDDMLDMAPLLQENS
  RLGCQIVLTPELEGAEFTLPKITRNFYVDGHVPKPH

• Structural information:
  • Protein Domains: (71..17-)
    (/note="2Fe-2S-ferredoxin-type)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00465"-)
  • Interpro: IPR036010  IPR001041  IPR001055  IPR018298  IPR012675  
  • Prosite: PS51085 PS00814
  • CDD: cd00207
  • PDB: 2Y5C
  • PDBsum: 2Y5C
  • STRING: ENSP00000377311
• Other Databases: GeneCards:  FDX2  Malacards:  FDX2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0009055	electron transfer activity	IEA	molecular function
GO:0051536	iron-sulfur cluster binding	IEA	molecular function
GO:0051537	2 iron, 2 sulfur cluster binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0051536	iron-sulfur cluster binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0051537	2 iron, 2 sulfur cluster binding	IEA	molecular function
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0006700	C21-steroid hormone biosynthetic process	TAS	biological process
GO:0016125	sterol metabolic process	TAS	biological process
GO:0044281	small molecule metabolic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0022900	electron transport chain	IEA	biological process
GO:0009055	electron transfer activity	IEA	molecular function
GO:0051536	iron-sulfur cluster binding	IEA	molecular function
GO:0051537	2 iron, 2 sulfur cluster binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0051536	iron-sulfur cluster binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0051537	2 iron, 2 sulfur cluster binding	IEA	molecular function
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0005759	mitochondrial matrix	TAS	cellular component
GO:0006700	C21-steroid hormone biosynthetic process	TAS	biological process
GO:0016125	sterol metabolic process	TAS	biological process
GO:0044281	small molecule metabolic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0022900	electron transport chain	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881