• Gene id: 11260

Gene Summary

• Gene Symbol: XPOT   Gene   UCSC   Ensembl
• Aliases: XPO3
• Gene name: exportin for tRNA
• Alternate names: exportin-T, exportin(tRNA), exportin, tRNA (nuclear export receptor for tRNAs), tRNA exportin,
• Gene location: 12q14.2 (64404391: 64451124)     Exons: 8     NC_000012.12
• Gene summary(Entrez): This gene encodes a protein belonging to the RAN-GTPase exportin family that mediates export of tRNA from the nucleus to the cytoplasm. Translocation of tRNA to the cytoplasm occurs once exportin has bound both tRNA and GTP-bound RAN. [provided by RefSeq,
• OMIM: 603180

Protein Summary

• Protein general information: O43592  
  • Name: Exportin T (Exportin(tRNA)) (tRNA exportin)
  • Length: 962  
  • Mass: 109964
• Sequence:

  MDEQALLGLNPNADSDFRQRALAYFEQLKISPDAWQVCAEALAQRTYSDDHVKFFCFQVLEHQVKYKYSELTTVQ
  QQLIRETLISWLQAQMLNPQPEKTFIRNKAAQVFALLFVTEYLTKWPKFFFDILSVVDLNPRGVDLYLRILMAID
  SELVDRDVVHTSEEARRNTLIKDTMREQCIPNLVESWYQILQNYQFTNSEVTCQCLEVVGAYVSWIDLSLIANDR
  FINMLLGHMSIEVLREEACDCLFEVVNKGMDPVDKMKLVESLCQVLQSAGFFSIDQEEDVDFLARFSKLVNGMGQ
  SLIVSWSKLIKNGDIKNAQEALQAIETKVALMLQLLIHEDDDISSNIIGFCYDYLHILKQLTVLSDQQKANVEAI
  MLAVMKKLTYDEEYNFENEGEDEAMFVEYRKQLKLLLDRLAQVSPELLLASVRRVFSSTLQNWQTTRFMEVEVAI
  RLLYMLAEALPVSHGAHFSGDVSKASALQDMMRTLVTSGVSSYQHTSVTLEFFETVVRYEKFFTVEPQHIPCVLM
  AFLDHRGLRHSSAKVRSRTAYLFSRFVKSLNKQMNPFIEDILNRIQDLLELSPPENGHQSLLSSDDQLFIYETAG
  VLIVNSEYPAERKQALMRNLLTPLMEKFKILLEKLMLAQDEERQASLADCLNHAVGFASRTSKAFSNKQTVKQCG
  CSEVYLDCLQTFLPALSCPLQKDILRSGVRTFLHRMIICLEEEVLPFIPSASEHMLKDCEAKDLQEFIPLINQIT
  AKFKIQVSPFLQQMFMPLLHAIFEVLLRPAEENDQSAALEKQMLRRSYFAFLQTVTGSGMSEVIANQGAENVERV
  LVTVIQGAVEYPDPIAQKTCFIILSKLVELWGGKDGPVGFADFVYKHIVPACFLAPLKQTFDLADAQTVLALSEC
  AVTLKTIHLKRGPECVQYLQQEYLPSLQVAPEIIQEFCQALQQPDAKVFKNYLKVFFQRAKP

• Structural information:
  • Interpro: IPR011989  IPR016024  IPR013598  IPR001494  IPR040017  
  • STRING: ENSP00000327821
• Other Databases: GeneCards:  XPOT  Malacards:  XPOT

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000049	tRNA binding	IBA	molecular function
GO:0016363	nuclear matrix	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0008536	Ran GTPase binding	IBA	molecular function
GO:0071528	tRNA re-export from nucleus	IBA	biological process
GO:0005643	nuclear pore	IDA	colocalizes with
GO:0000049	tRNA binding	IDA	molecular function
GO:0006409	tRNA export from nucleus	IDA	biological process
GO:0000049	tRNA binding	IEA	molecular function
GO:0006409	tRNA export from nucleus	IEA	biological process
GO:0006886	intracellular protein transport	IEA	biological process
GO:0008536	Ran GTPase binding	IEA	molecular function
GO:0071528	tRNA re-export from nucleus	IEA	biological process
GO:0000049	tRNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0006409	tRNA export from nucleus	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03013	RNA transport

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq