• Gene id: 11182

Gene Summary

• Gene Symbol: SLC2A6   Gene   UCSC   Ensembl
• Aliases: GLUT6, GLUT9, HSA011372
• Gene name: solute carrier family 2 member 6
• Alternate names: solute carrier family 2, facilitated glucose transporter member 6, GLUT-6, GLUT-9, glucose transporter type 6, glucose transporter type 9, solute carrier family 2 (facilitated glucose transporter), member 6,
• Gene location: 9q34.2 (133479126: 133471093)     Exons: 10     NC_000009.12
• Gene summary(Entrez): Hexose transport into mammalian cells is catalyzed by a family of membrane proteins, including SLC2A6, that contain 12 transmembrane domains and a number of critical conserved residues.[supplied by OMIM, Jul 2002]
• OMIM: 605561

Protein Summary

• Protein general information: Q9UGQ3  
  • Name: Solute carrier family 2, facilitated glucose transporter member 6 (Glucose transporter type 6) (GLUT 6)
  • Length: 507  
  • Mass: 54539
  • Tissue specificity: Highly expressed in brain, spleen and peripheral blood leukocytes. {ECO
• Sequence:

  MQEPLLGAEGPDYDTFPEKPPPSPGDRARVGTLQNKRVFLATFAAVLGNFSFGYALVYTSPVIPALERSLDPDLH
  LTKSQASWFGSVFTLGAAAGGLSAMILNDLLGRKLSIMFSAVPSAAGYALMAGAHGLWMLLLGRTLTGFAGGLTA
  ACIPVYVSEIAPPGVRGALGATPQLMAVFGSLSLYALGLLLPWRWLAVAGEAPVLIMILLLSFMPNSPRFLLSRG
  RDEEALRALAWLRGTDVDVHWEFEQIQDNVRRQSSRVSWAEARAPHVCRPITVALLMRLLQQLTGITPILVYLQS
  IFDSTAVLLPPKDDAAIVGAVRLLSVLIAALTMDLAGRKVLLFVSAAIMFAANLTLGLYIHFGPRPLSPNSTAGL
  ESESWGDLAQPLAAPAGYLTLVPLLATMLFIMGYAVGWGPITWLLMSEVLPLRARGVASGLCVLASWLTAFVLTK
  SFLPVVSTFGLQVPFFFFAAICLVSLVFTGCCVPETKGRSLEQIESFFRTGRRSFLR

• Structural information:
  • Interpro: IPR020846  IPR005828  IPR036259  IPR003663  IPR005829  
  • Prosite: PS50850 PS00216 PS00217
  • STRING: ENSP00000360966
• Other Databases: GeneCards:  SLC2A6  Malacards:  SLC2A6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0046323	glucose import	IBA	biological process
GO:0005351	carbohydrate:proton symporter activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0005765	lysosomal membrane	IDA	cellular component
GO:1904659	glucose transmembrane transport	IDA	NOT|biological process
GO:0005355	glucose transmembrane transporter activity	IDA	NOT|molecular function
GO:0070837	dehydroascorbic acid transport	ISS	biological process
GO:0006110	regulation of glycolytic process	IMP	biological process
GO:0033300	dehydroascorbic acid transmembrane transporter activity	ISS	molecular function
GO:0005355	glucose transmembrane transporter activity	ISS	molecular function
GO:0005353	fructose transmembrane transporter activity	ISS	molecular function
GO:1904659	glucose transmembrane transport	ISS	biological process
GO:0015755	fructose transmembrane transport	ISS	biological process
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0005764	lysosome	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0008643	carbohydrate transport	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0008645	hexose transmembrane transport	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0006110	regulation of glycolytic process	IEA	biological process
GO:0005765	lysosomal membrane	IEA	cellular component
GO:1902600	proton transmembrane transport	IEA	biological process
GO:0016020	membrane	NAS	cellular component
GO:0005355	glucose transmembrane transporter activity	NAS	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq