Search Result
| Gene id | 11162 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | NUDT6 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Aliases | ASFGF2, FGF-AS, FGF2AS, GFG-1, GFG1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene name | nudix hydrolase 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternate names | nucleoside diphosphate-linked moiety X motif 6, antisense basic fibroblast growth factor, nudix (nucleoside diphosphate linked moiety X)-type motif 6, | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene location |
4q28.1 (122922967: 122892576) Exons: 10 NC_000004.12 |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
This gene overlaps and lies on the opposite strand from FGF2 gene, and is thought to be the FGF2 antisense gene. The two genes are independently transcribed, and their expression shows an inverse relationship, suggesting that this antisense transcript may |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMIM | 606261 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Protein general information | P53370 Name: Nucleoside diphosphate linked moiety X motif 6 (Nudix motif 6) (EC 3.6.1. ) (Antisense basic fibroblast growth factor) (Protein GFG) Length: 316 Mass: 35679 Tissue specificity: Detected in liver, kidney and esophagus (at protein level). Ubiquitous. {ECO | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence |
MRQPLSWGRWRAMLARTYGPGPSAGYRWASGAQGYVRNPPVGACDLQGELDRFGGISVRLARLDALDRLDAAAFQ KGLQAAVQQWRSEGRTAVWLHIPILQSRFIAPAASLGFCFHHAESDSSTLTLWLREGPSRLPGYASHQVGVAGAV FDESTRKILVVQDRNKLKNMWKFPGGLSEPEEDIGDTAVREVFEETGIKSEFRSVLSIRQQHTNPGAFGKSDMYI ICRLKPYSFTINFCQEECLRCEWMDLNDLAKTENTTPITSRVARLLLYGYREGFDKIDLTVEELPAVYTGLFYKL YHKELPENYKTMKGID | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: NUDT6  Malacards: NUDT6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||