• Gene id: 11153

Gene Summary

• Gene Symbol: FICD   Gene   UCSC   Ensembl
• Aliases: HIP13, HYPE, UNQ3041
• Gene name: FIC domain protein adenylyltransferase
• Alternate names: protein adenylyltransferase FICD, AMPylator FICD, FIC domain containing, FIC domain-containing protein, HIP-13, Huntingtin interacting protein E, adenosine monophosphate-protein transferase FICD, de-AMPylase FICD, fic S-phase protein cell division homolog, hunting,
• Gene location: 12q23.3 (179653039: 179789400)     Exons: 22     NC_000003.12

Protein Summary

• Protein general information: Q9BVA6  
  • Name: Protein adenylyltransferase FICD (EC 2.7.7.n1) (AMPylator FICD) (De AMPylase FICD) (EC 3.1.4. ) (FIC domain containing protein) (Huntingtin yeast partner E) (Huntingtin interacting protein 13) (HIP 13) (Huntingtin interacting protein E)
  • Length: 458  
  • Mass: 51778
  • Tissue specificity: Ubiquitous. {ECO
• Sequence:

  MMLIPMASVMAVTEPKWVSVWSRFLWVTLLSMVLGSLLALLLPLGAVEEQCLAVLKGLYLLRSKPDRAQHAATKC
  TSPSTELSITSRGATLLVAKTKASPAGKLEARAALNQALEMKRQGKREKAQKLFMHALKMDPDFVDALTEFGIFS
  EEDKDIIQADYLYTRALTISPYHEKALVNRDRTLPLVEEIDQRYFSIIDSKVKKVMSIPKGNSALRRVMEETYYH
  HIYHTVAIEGNTLTLSEIRHILETRYAVPGKSLEEQNEVIGMHAAMKYINTTLVSRIGSVTISDVLEIHRRVLGY
  VDPVEAGRFRTTQVLVGHHIPPHPQDVEKQMQEFVQWLNSEEAMNLHPVEFAALAHYKLVYIHPFIDGNGRTSRL
  LMNLILMQAGYPPITIRKEQRSDYYHVLEAANEGDVRPFIRFIAKCTETTLDTLLFATTEYSVALPEAQPNHSGF
  KETLPVKP

• Structural information:
  • Protein Domains: (285..42-)
    (/note="Fido-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00791"-)
  • Interpro: IPR003812  IPR036597  IPR040198  IPR013026  IPR011990   IPR019734  
  • Prosite: PS51459 PS50005 PS50293
  • PDB: 4U04 4U07 4U0S 4U0U 4U0Z 6I7G 6I7H 6I7I 6I7J 6I7K 6I7L
  • PDBsum: 4U04 4U07 4U0S 4U0U 4U0Z 6I7G 6I7H 6I7I 6I7J 6I7K 6I7L
  • DIP: 44884
  • STRING: ENSP00000446479
• Other Databases: GeneCards:  FICD  Malacards:  FICD

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030176	integral component of endoplasmic reticulum membrane	IDA	cellular component
GO:1903894	regulation of IRE1-mediated unfolded protein response	IDA	biological process
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0051087	chaperone binding	IDA	molecular function
GO:0034976	response to endoplasmic reticulum stress	IDA	biological process
GO:0018117	protein adenylylation	IDA	biological process
GO:0070733	protein adenylyltransferase activity	IDA	molecular function
GO:0005524	ATP binding	IDA	molecular function
GO:0018117	protein adenylylation	IDA	biological process
GO:0070733	protein adenylyltransferase activity	IDA	molecular function
GO:0070733	protein adenylyltransferase activity	IDA	molecular function
GO:0070733	protein adenylyltransferase activity	IDA	molecular function
GO:0018117	protein adenylylation	IDA	biological process
GO:0044603	protein adenylylhydrolase activity	ISS	molecular function
GO:0034260	negative regulation of GTPase activity	TAS	biological process
GO:0044602	protein deadenylylation	ISS	biological process
GO:0030544	Hsp70 protein binding	IPI	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0006986	response to unfolded protein	IEA	biological process
GO:0016779	nucleotidyltransferase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray