• Gene id: 11129

Gene Summary

• Gene Symbol: CLASRP   Gene   UCSC   Ensembl
• Aliases: CLASP, SFRS16, SWAP2
• Gene name: CLK4 associating serine/arginine rich protein
• Alternate names: CLK4-associating serine/arginine rich protein, Clk4 associating SR-related protein, splicing factor, arginine/serine-rich 16 (suppressor-of-white-apricot homolog, Drosophila), suppressor of white apricot homolog 2,
• Gene location: 19q13.32 (45039044: 45070955)     Exons: 21     NC_000019.10
• OMIM: 603873

Protein Summary

• Protein general information: Q8N2M8  
  • Name: CLK4 associating serine/arginine rich protein (Splicing factor, arginine/serine rich 16) (Suppressor of white apricot homolog 2)
  • Length: 674  
  • Mass: 77161
• Sequence:

  MWHEARKHERKLRGMMVDYKKRAERRREYYEKIKKDPAQFLQVHGRACKVHLDSAVALAAESPVNMMPWQGDTNN
  MIDRFDVRAHLDHIPDYTPPLLTTISPEQESDERKCNYERYRGLVQNDFAGISEEQCLYQIYIDELYGGLQRPSE
  DEKKKLAEKKASIGYTYEDSTVAKVEKAAEKPEEEESAAEEESNSDEDEVIPDIDVEVDVDELNQEQVADLNKQA
  TTYGMADGDFVRMLRKDKEEAEAIKHAKALEEEKAMYSGRRSRRQRREFREKRLRGRKISPPSYARRDSPTYDPY
  KRSPSESSSESRSRSRSPTPGREEKITFITSFGGSDEEAAAAAAAAAASGVTTGKPPAPPQPGGPAPGRNASARR
  RSSSSSSSSSASRTSSSRSSSRSSSRSRRGGGYYRSGRHARSRSRSWSRSRSRSRRYSRSRSRGRRHSGGGSRDG
  HRYSRSPARRGGYGPRRRSRSRSHSGDRYRRGGRGLRHHSSSRSRSSWSLSPSRSRSLTRSRSHSPSPSQSRSRS
  RSRSQSPSPSPAREKLTRPAASPAVGEKLKKTEPAAGKETGAAKPKLTPQEKLKLRMQKALNRQFKADKKAAQEK
  MIQQEHERQEREDELRAMARKIRMKERERREKEREEWERQYSRQSRSPSPRYSREYSSSRRRSRSRSRSPHYRH

• Structural information:
  • Interpro: IPR040397  IPR019147  
  • STRING: ENSP00000221455
• Other Databases: GeneCards:  CLASRP  Malacards:  CLASRP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IEA	cellular component
GO:0008380	RNA splicing	IEA	biological process
GO:0006397	mRNA processing	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq