Search Result
| Gene id | 11061 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | CNMD Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Aliases | BRICD3, CHM-I, CHM1, LECT1, MYETS1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene name | chondromodulin | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternate names | leukocyte cell-derived chemotaxin 1, BRICHOS domain containing 3, chondromodulin-1, chondromodulin-I, leukocyte cell derived chemotaxin 1, multiple myeloma tumor suppressor 1, | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene location |
13q14.3 (52739819: 52703263) Exons: 7 NC_000013.11 |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
This gene encodes a glycosylated transmembrane protein that is cleaved to form a mature, secreted protein. The N-terminus of the precursor protein shares characteristics with other surfactant proteins and is sometimes called chondrosurfactant protein alth |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMIM | 605147 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Protein general information | O75829 Name: Leukocyte cell derived chemotaxin 1 (Chondromodulin) [Cleaved into: Chondrosurfactant protein (CH SP); Chondromodulin 1 (Chondromodulin I) (ChM I)] Length: 334 Mass: 37102 Tissue specificity: Detected in cartilage and cardiac valves (at protein level). Detected in the laminae fibrosa, spongiosa and ventricularis layers of normal cardiac valves (at protein level). Expression is decreased cardiac valves of patients with valvu | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence |
MTENSDKVPIALVGPDDVEFCSPPAYATLTVKPSSPARLLKVGAVVLISGAVLLLFGAIGAFYFWKGSDSHIYNV HYTMSINGKLQDGSMEIDAGNNLETFKMGSGAEEAIAVNDFQNGITGIRFAGGEKCYIKAQVKARIPEVGAVTKQ SISSKLEGKIMPVKYEENSLIWVAVDQPVKDNSFLSSKVLELCGDLPIFWLKPTYPKEIQRERREVVRKIVPTTT KRPHSGPRSNPGAGRLNNETRPSVQEDSQAFNPDNPYHQQEGESMTFDPRLDHEGICCIECRRSYTHCQKICEPL GGYYPWPYNYQGCRSACRVIMPCSWWVARILGMV | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: CNMD  Malacards: CNMD | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||