Search Result
| Gene id | 11026 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | LILRA3 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Aliases | CD85E, HM31, HM43, ILT-6, ILT6, LIR-4, LIR4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene name | leukocyte immunoglobulin like receptor A3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternate names | leukocyte immunoglobulin-like receptor subfamily A member 3, CD85 antigen-like family member E, immunoglobulin-like transcript 6, leucocyte Ig-like receptor A3, leukocyte immunoglobulin-like receptor 4, leukocyte immunoglobulin-like receptor, subfamily A (with, | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene location |
19q13.4 (: ) Exons: |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
This gene encodes a member of a family of immunoreceptors that are expressed predominantly in monocytes and B cells, and at lower levels in dendritic cells and natural killer cells. The encoded protein lacks the transmembrane region found in other members |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMIM | 608256 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Protein general information | Q8N6C8 Name: Leukocyte immunoglobulin like receptor subfamily A member 3 (CD85 antigen like family member E) (Immunoglobulin like transcript 6) (ILT 6) (Leukocyte immunoglobulin like receptor 4) (LIR 4) (Monocyte inhibitory receptor HM43/HM31) (CD antigen CD85e) Length: 439 Mass: 47472 Tissue specificity: Detected in B-cells, and at lower levels in natural killer (NK) cells. Detected in peripheral blood monocytes and lung. {ECO | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence |
MTPILTVLICLGLSLDPRTHVQAGPLPKPTLWAEPGSVITQGSPVTLRCQGSLETQEYHLYREKKTALWITRIPQ ELVKKGQFPILSITWEHAGRYCCIYGSHTAGLSESSDPLELVVTGAYSKPTLSALPSPVVTSGGNVTIQCDSQVA FDGFILCKEGEDEHPQCLNSHSHARGSSRAIFSVGPVSPSRRWSYRCYGYDSRAPYVWSLPSDLLGLLVPGVSKK PSLSVQPGPVVAPGEKLTFQCGSDAGYDRFVLYKEWGRDFLQRPGRQPQAGLSQANFTLGPVSRSYGGQYTCSGA YNLSSEWSAPSDPLDILITGQIRARPFLSVRPGPTVASGENVTLLCQSQGGMHTFLLTKEGAADSPLRLKSKRQS HKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHPSDPLELVVSGAAETLSPPQNKSDSKAGE | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: LILRA3  Malacards: LILRA3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
KEGG pathways
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||