• Gene id: 11000

Gene Summary

• Gene Symbol: SLC27A3   Gene   UCSC   Ensembl
• Aliases: ACSVL3, FATP3, VLCS-3
• Gene name: solute carrier family 27 member 3
• Alternate names: solute carrier family 27 member 3, arachidonate--CoA ligase, long-chain fatty acid transport protein 3, solute carrier family 27 (fatty acid transporter), member 3, very long-chain acyl-CoA synthetase homolog 3,
• Gene location: 1q21.3 (129964273: 129835232)     Exons: 18     NC_000010.11
• Gene summary(Entrez): This gene belongs to a family of integral membrane proteins and encodes a protein that is involved in lipid metabolism. The increased expression of this gene in human neural stem cells derived from induced pluripotent stem cells suggests that it plays an
• OMIM: 604193

Protein Summary

• Protein general information: Q5K4L6  
  • Name: Solute carrier family 27 member 3 (EC 6.2.1. ) (Arachidonate CoA ligase) (EC 6.2.1.15) (Long chain fatty acid transport protein 3) (FATP 3) (Fatty acid transport protein 3) (Very long chain acyl CoA synthetase homolog 3) (VLCS 3)
  • Length: 683  
  • Mass: 73550
  • Tissue specificity: Expressed in bronchial and bronchiolar epithelial cells (at protein level). {ECO
• Sequence:

  MAALLLLPLLLLLPLLLLKLHLWPQLRWLPADLAFAVRALCCKRALRARALAAAAADPEGPEGGCSLAWRLAELA
  QQRAAHTFLIHGSRRFSYSEAERESNRAARAFLRALGWDWGPDGGDSGEGSAGEGERAAPGAGDAAAGSGAEFAG
  GDGAARGGGAAAPLSPGATVALLLPAGPEFLWLWFGLAKAGLRTAFVPTALRRGPLLHCLRSCGARALVLAPEFL
  ESLEPDLPALRAMGLHLWAAGPGTHPAGISDLLAEVSAEVDGPVPGYLSSPQSITDTCLYIFTSGTTGLPKAARI
  SHLKILQCQGFYQLCGVHQEDVIYLALPLYHMSGSLLGIVGCMGIGATVVLKSKFSAGQFWEDCQQHRVTVFQYI
  GELCRYLVNQPPSKAERGHKVRLAVGSGLRPDTWERFVRRFGPLQVLETYGLTEGNVATINYTGQRGAVGRASWL
  YKHIFPFSLIRYDVTTGEPIRDPQGHCMATSPGEPGLLVAPVSQQSPFLGYAGGPELAQGKLLKDVFRPGDVFFN
  TGDLLVCDDQGFLRFHDRTGDTFRWKGENVATTEVAEVFEALDFLQEVNVYGVTVPGHEGRAGMAALVLRPPHAL
  DLMQLYTHVSENLPPYARPRFLRLQESLATTETFKQQKVRMANEGFDPSTLSDPLYVLDQAVGAYLPLTTARYSA
  LLAGNLRI

• Structural information:
  • Interpro: IPR025110  IPR020845  IPR000873  IPR042099  IPR030307  
  • Prosite: PS00455
  • STRING: ENSP00000485061
• Other Databases: GeneCards:  SLC27A3  Malacards:  SLC27A3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0005739	mitochondrion	IBA	cellular component
GO:0005324	long-chain fatty acid transporter activity	IBA	molecular function
GO:0004467	long-chain fatty acid-CoA ligase activity	IBA	molecular function
GO:0001676	long-chain fatty acid metabolic process	IDA	biological process
GO:0031957	very long-chain fatty acid-CoA ligase activity	IDA	molecular function
GO:0004467	long-chain fatty acid-CoA ligase activity	IDA	molecular function
GO:0005739	mitochondrion	IDA	cellular component
GO:0003824	catalytic activity	IEA	molecular function
GO:0004467	long-chain fatty acid-CoA ligase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0031957	very long-chain fatty acid-CoA ligase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016874	ligase activity	IEA	molecular function
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0047676	arachidonate-CoA ligase activity	IEA	molecular function
GO:0031966	mitochondrial membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0015909	long-chain fatty acid transport	IEA	biological process
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04931	Insulin resistance

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray