• Gene id: 10993

Gene Summary

• Gene Symbol: SDS   Gene   UCSC   Ensembl
• Aliases: SDH
• Gene name: serine dehydratase
• Alternate names: L-serine dehydratase/L-threonine deaminase, L-serine ammonia-lyase, L-serine deaminase, L-serine dehydratase, L-threonine dehydratase, TDH,
• Gene location: 12q24.13 (113403886: 113392444)     Exons: 8     NC_000012.12
• Gene summary(Entrez): This gene encodes one of three enzymes that are involved in metabolizing serine and glycine. L-serine dehydratase converts L-serine to pyruvate and ammonia and requires pyridoxal phosphate as a cofactor. The encoded protein can also metabolize threonine t
• OMIM: 604194

Protein Summary

• Protein general information: P20132  
  • Name: L serine dehydratase/L threonine deaminase (SDH) (EC 4.3.1.17) (L serine deaminase) (L threonine dehydratase) (TDH) (EC 4.3.1.19)
  • Length: 328  
  • Mass: 34625
• Sequence:

  MMSGEPLHVKTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQGCAHFVCSSAGNAGMAAAYA
  ARQLGVPATIVVPSTTPALTIERLKNEGATVKVVGELLDEAFELAKALAKNNPGWVYIPPFDDPLIWEGHASIVK
  ELKETLWEKPGAIALSVGGGGLLCGVVQGLQEVGWGDVPVIAMETFGAHSFHAATTAGKLVSLPKITSVAKALGV
  KTVGAQALKLFQEHPIFSEVISDQEAVAAIEKFVDDEKILVEPACGAALAAVYSHVIQKLQLEGNLRTPLPSLVV
  IVCGGSNISLAQLRALKEQLGMTNRLPK

• Structural information:
  • Interpro: IPR001926  IPR000634  IPR036052  
  • Prosite: PS00165
  • PDB: 1P5J 4H27
  • PDBsum: 1P5J 4H27
  • STRING: ENSP00000257549
• Other Databases: GeneCards:  SDS  Malacards:  SDS

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006565	L-serine catabolic process	IBA	biological process
GO:0003941	L-serine ammonia-lyase activity	IBA	molecular function
GO:0004794	L-threonine ammonia-lyase activity	IBA	molecular function
GO:0006567	threonine catabolic process	IBA	biological process
GO:0030170	pyridoxal phosphate binding	IEA	molecular function
GO:0006520	cellular amino acid metabolic process	IEA	biological process
GO:0016829	lyase activity	IEA	molecular function
GO:0006094	gluconeogenesis	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0004794	L-threonine ammonia-lyase activity	IEA	molecular function
GO:0003941	L-serine ammonia-lyase activity	IEA	molecular function
GO:0019518	L-threonine catabolic process to glycine	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0006094	gluconeogenesis	IEA	biological process
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0030170	pyridoxal phosphate binding	IDA	molecular function
GO:0006565	L-serine catabolic process	IDA	biological process
GO:0042866	pyruvate biosynthetic process	IDA	biological process
GO:0003941	L-serine ammonia-lyase activity	IDA	molecular function
GO:0003941	L-serine ammonia-lyase activity	IDA	molecular function
GO:0006565	L-serine catabolic process	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa01200	Carbon metabolism
hsa01230	Biosynthesis of amino acids
hsa00270	Cysteine and methionine metabolism
hsa00260	Glycine, serine and threonine metabolism
hsa00290	Valine, leucine and isoleucine biosynthesis

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq