Search Result
| Gene id | 10957 | ||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||
| Gene Symbol | PNRC1 Gene UCSC Ensembl | ||||||||||||||||||||||||
| Aliases | B4-2, PNAS-145, PROL2, PRR2 | ||||||||||||||||||||||||
| Gene name | proline rich nuclear receptor coactivator 1 | ||||||||||||||||||||||||
| Alternate names | proline-rich nuclear receptor coactivator 1, proline rich 2 protein, proline-rich polypeptide 2, proline-rich protein 2, proline-rich protein with nuclear targeting signal, protein B4-2, | ||||||||||||||||||||||||
| Gene location |
6q15 (89080748: 89085159) Exons: 3 NC_000006.12 |
||||||||||||||||||||||||
| OMIM | 606714 | ||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||
| Protein general information | Q12796 Name: Proline rich nuclear receptor coactivator 1 (Proline rich protein 2) (Protein B4 2) Length: 327 Mass: 35225 Tissue specificity: Expressed in liver, lung, fat and NK/T cells. {ECO | ||||||||||||||||||||||||
| Sequence |
MTVVSVPQREPLVLGGRLAPLGFSSRGYFGALPMVTTAPPPLPRIPDPRALPPTLFLPHFLGGDGPCLTPQPRAP AALPNRSLAVAGGTPRAAPKKRRKKKVRASPAGQLPSRFHQYQQHRPSLEGGRSPATGPSGAQEVPGPAAALAPS PAAAAGTEGASPDLAPLRPAAPGQTPLRKEVLKSKMGKSEKIALPHGQLVHGIHLYEQPKINRQKSKYNLPLTKI TSAKRNENNFWQDSVSSDRIQKQEKKPFKNTENIKNSHLKKSAFLTEVSQKENYAGAKFSDPPSPSVLPKPPSHW MGSTVENSNQNRELMAVHLKTLLKVQT | ||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||
| Other Databases | GeneCards: PNRC1  Malacards: PNRC1 | ||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||
| |||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||
| |||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||
| |||||||||||||||||||||||||