• Gene id: 10950

Gene Summary

• Gene Symbol: BTG3   Gene   UCSC   Ensembl
• Aliases: ANA, ANA/BTG3, APRO4, TOB5, TOB55, TOFA
• Gene name: BTG anti-proliferation factor 3
• Alternate names: protein BTG3, B-cell translocation gene 3, BTG family member 3, abundant in neuroepithelium area protein, protein Tob5,
• Gene location: 21q21.1 (17612939: 17593652)     Exons: 7     NC_000021.9
• Gene summary(Entrez): The protein encoded by this gene is a member of the BTG/Tob family. This family has structurally related proteins that appear to have antiproliferative properties. This encoded protein might play a role in neurogenesis in the central nervous system. Two t
• OMIM: 605674

Protein Summary

• Protein general information: Q14201  
  • Name: Protein BTG3 (Abundant in neuroepithelium area protein) (BTG family member 3) (Protein Tob5)
  • Length: 252  
  • Mass: 29116
  • Tissue specificity: Ubiquitous. High expression in the ventricular zone of the developing central nervous system. High in ovary, testis, prostate, thymus and lung. {ECO
• Sequence:

  MKNEIAAVVFFFTRLVRKHDKLKKEAVERFAEKLTLILQEKYKNHWYPEKPSKGQAYRCIRVNKFQRVDPDVLKA
  CENSCILYSDLGLPKELTLWVDPCEVCCRYGEKNNAFIVASFENKDENKDEISRKVTRALDKVTSDYHSGSSSSD
  EETSKEMEVKPSSVTAAASPVYQISELIFPPLPMWHPLPRKKPGMYRGNGHQNHYPPPVPFGYPNQGRKNKPYRP
  IPVTWVPPPGMHCDRNHWINPHMLAPH

• Structural information:
  • Interpro: IPR002087  IPR036054  
  • Prosite: PS00960 PS01203
• Other Databases: GeneCards:  BTG3  Malacards:  BTG3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008285	negative regulation of cell population proliferation	IBA	biological process
GO:0045930	negative regulation of mitotic cell cycle	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0008285	negative regulation of cell population proliferation	TAS	biological process
GO:0045930	negative regulation of mitotic cell cycle	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03018	RNA degradation

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)