• Gene id: 10917

Gene Summary

• Gene Symbol: BTNL3   Gene   UCSC   Ensembl
• Aliases: BTN9.1, BTNLR
• Gene name: butyrophilin like 3
• Alternate names: butyrophilin-like protein 3, butyrophilin-like receptor,
• Gene location: 5q35.3 (180988845: 181006726)     Exons: 8     NC_000005.10
• OMIM: 612489

Protein Summary

• Protein general information: Q6UXE8  
  • Name: Butyrophilin like protein 3 (Butyrophilin like receptor)
  • Length: 466  
  • Mass: 52251
  • Tissue specificity: Expressed in small intestine, colon, testis, spleen, and leukocyte. {ECO
• Sequence:

  MAFVLILVLSFYELVSGQWQVTGPGKFVQALVGEDAVFSCSLFPETSAEAMEVRFFRNQFHAVVHLYRDGEDWES
  KQMPQYRGRTEFVKDSIAGGRVSLRLKNITPSDIGLYGCWFSSQIYDEEATWELRVAALGSLPLISIVGYVDGGI
  QLLCLSSGWFPQPTAKWKGPQGQDLSSDSRANADGYSLYDVEISIIVQENAGSILCSIHLAEQSHEVESKVLIGE
  TFFQPSPWRLASILLGLLCGALCGVVMGMIIVFFKSKGKIQAELDWRRKHGQAELRDARKHAVEVTLDPETAHPK
  LCVSDLKTVTHRKAPQEVPHSEKRFTRKSVVASQGFQAGKHYWEVDVGQNVGWYVGVCRDDVDRGKNNVTLSPNN
  GYWVLRLTTEHLYFTFNPHFISLPPSTPPTRVGVFLDYEGGTISFFNTNDQSLIYTLLTCQFEGLLRPYIQHAMY
  DEEKGTPIFICPVSWG

• Structural information:
  • Protein Domains: (138..21-)
    (/note="Ig-like-V-type)
    (270..46-)
    (/note="B30.2/SPRY-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00548"-)
  • Interpro: IPR001870  IPR003879  IPR013320  IPR007110  IPR036179   IPR013783  IPR003599  IPR013106  IPR006574  IPR003877  
  • Prosite: PS50188 PS50835
  • STRING: ENSP00000341787
• Other Databases: GeneCards:  BTNL3  Malacards:  BTNL3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005102	signaling receptor binding	IBA	molecular function
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0050852	T cell receptor signaling pathway	IBA	biological process
GO:0001817	regulation of cytokine production	IBA	biological process
GO:0050776	regulation of immune response	IBA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0003674	molecular_function	ND	molecular function
GO:0005575	cellular_component	ND	cellular component
GO:0008150	biological_process	ND	biological process
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R