• Gene id: 10915

Gene Summary

• Gene Symbol: TCERG1   Gene   UCSC   Ensembl
• Aliases: CA150, TAF2S, Urn1
• Gene name: transcription elongation regulator 1
• Alternate names: transcription elongation regulator 1, TATA box binding protein (TBP)-associated factor, RNA polymerase II, S, 150kD, TATA box-binding protein-associated factor 2S, co-activator of 150 kDa, transcription factor CA150,
• Gene location: 5q32 (146447329: 146511960)     Exons: 28     NC_000005.10
• Gene summary(Entrez): This gene encodes a nuclear protein that regulates transcriptional elongation and pre-mRNA splicing. The encoded protein interacts with the hyperphosphorylated C-terminal domain of RNA polymerase II via multiple FF domains, and with the pre-mRNA splicing
• OMIM: 605409

Protein Summary

• Protein general information: O14776  
  • Name: Transcription elongation regulator 1 (TATA box binding protein associated factor 2S) (Transcription factor CA150)
  • Length: 1098  
  • Mass: 123901
  • Tissue specificity: Detected in brain neurons. {ECO
• Sequence:

  MAERGGDGGESERFNPGELRMAQQQALRFRGPAPPPNAVMRGPPPLMRPPPPFGMMRGPPPPPRPPFGRPPFDPN
  MPPMPPPGGIPPPMGPPHLQRPPFMPPPMSSMPPPPGMMFPPGMPPVTAPGTPALPPTEEIWVENKTPDGKVYYY
  NARTRESAWTKPDGVKVIQQSELTPMLAAQAQVQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQA
  QAQAQAQAQAQAQAQAQVQAQVQAQVQAQAVGASTPTTSSPAPAVSTSTSSSTPSSTTSTTTTATSVAQTVSTPT
  TQDQTPSSAVSVATPTVSVSTPAPTATPVQTVPQPHPQTLPPAVPHSVPQPTTAIPAFPPVMVPPFRVPLPGMPI
  PLPGVAMMQIVSCPYVKTVATTKTGVLPGMAPPIVPMIHPQVAIAASPATLAGATAVSEWTEYKTADGKTYYYNN
  RTLESTWEKPQELKEKEKLEEKIKEPIKEPSEEPLPMETEEEDPKEEPIKEIKEEPKEEEMTEEEKAAQKAKPVA
  TAPIPGTPWCVVWTGDERVFFYNPTTRLSMWDRPDDLIGRADVDKIIQEPPHKKGMEELKKLRHPTPTMLSIQKW
  QFSMSAIKEEQELMEEINEDEPVKAKKRKRDDNKDIDSEKEAAMEAEIKAARERAIVPLEARMKQFKDMLLERGV
  SAFSTWEKELHKIVFDPRYLLLNPKERKQVFDQYVKTRAEEERREKKNKIMQAKEDFKKMMEEAKFNPRATFSEF
  AAKHAKDSRFKAIEKMKDREALFNEFVAAARKKEKEDSKTRGEKIKSDFFELLSNHHLDSQSRWSKVKDKVESDP
  RYKAVDSSSMREDLFKQYIEKIAKNLDSEKEKELERQARIEASLREREREVQKARSEQTKEIDREREQHKREEAI
  QNFKALLSDMVRSSDVSWSDTRRTLRKDHRWESGSLLEREEKEKLFNEHIEALTKKKREHFRQLLDETSAITLTS
  TWKEVKKIIKEDPRCIKFSSSDRKKQREFEEYIRDKYITAKADFRTLLKETKFITYRSKKLIQESDQHLKDVEKI
  LQNDKRYLVLDCVPEERRKLIVAYVDDLDRRGPPPPPTASEPTRRSTK

• Structural information:
  • Protein Domains: (131..16-)
    (/note="WW-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00224-)
    (429..46-)
    (/note="WW-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00224-)
    (528..56-)
    (/note="WW-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00224-)
    (-)
  • Interpro: IPR002713  IPR036517  IPR001202  IPR036020  
  • Prosite: PS51676 PS01159 PS50020
  • CDD: cd00201
  • PDB: 2DK7 2DOD 2DOE 2DOF 2E71 2KIQ 2KIS 2MW9 2MWA 2MWB 2MWD 2MWE 2MWF 2N4R 2N4S 2N4T 2N4U 2N4V 2N4W 2NNT 3HFH 3Q1I 4FQG
  • PDBsum: 2DK7 2DOD 2DOE 2DOF 2E71 2KIQ 2KIS 2MW9 2MWA 2MWB 2MWD 2MWE 2MWF 2N4R 2N4S 2N4T 2N4U 2N4V 2N4W 2NNT 3HFH 3Q1I 4FQG
  • DIP: 32504
  • STRING: ENSP00000296702
• Other Databases: GeneCards:  TCERG1  Malacards:  TCERG1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006397	mRNA processing	IDA	biological process
GO:0008380	RNA splicing	IDA	biological process
GO:0003711	transcription elongation regulator activity	TAS	molecular function
GO:0070063	RNA polymerase binding	TAS	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0044390	ubiquitin-like protein conjugating enzyme binding	IPI	molecular function
GO:0016607	nuclear speck	TAS	cellular component
GO:0032968	positive regulation of transcription elongation from RNA polymerase II promoter	TAS	biological process
GO:0034244	negative regulation of transcription elongation from RNA polymerase II promoter	TAS	biological process
GO:0070063	RNA polymerase binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0003712	transcription coregulator activity	IBA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003713	transcription coactivator activity	TAS	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070064	proline-rich region binding	IEA	molecular function
GO:0003714	transcription corepressor activity	IDA	molecular function
GO:0001103	RNA polymerase II repressing transcription factor binding	IPI	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03040	Spliceosome

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 21412036
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21412036	Cryptorchidism			23 (4 controls, 19 cases)	Male infertility	GSE25518 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R