• Gene id: 10906

Gene Summary

• Gene Symbol: TRAFD1   Gene   UCSC   Ensembl
• Aliases: FLN29
• Gene name: TRAF-type zinc finger domain containing 1
• Alternate names: TRAF-type zinc finger domain-containing protein 1, FLN29 gene product,
• Gene location: 12q24.13 (112125544: 112153603)     Exons: 12     NC_000012.12
• Gene summary(Entrez): The innate immune system confers host defense against viral and microbial infection, and TRAFD1 is a negative feedback regulator that controls excessive immune responses (Sanada et al., 2008 [PubMed 18849341]).[supplied by OMIM, Dec 2009]
• OMIM: 611823

Protein Summary

• Protein general information: O14545  
  • Name: TRAF type zinc finger domain containing protein 1 (Protein FLN29)
  • Length: 582  
  • Mass: 64841
• Sequence:

  MAEFLDDQETRLCDNCKKEIPVFNFTIHEIHCQRNIGMCPTCKEPFPKSDMETHMAAEHCQVTCKCNKKLEKRLL
  KKHEETECPLRLAVCQHCDLELSILKLKEHEDYCGARTELCGNCGRNVLVKDLKTHPEVCGREGEEKRNEVAIPP
  NAYDESWGQDGIWIASQLLRQIEALDPPMRLPRRPLRAFESDVFHNRTTNQRNITAQVSIQNNLFEEQERQERNR
  GQQPPKEGGEESANLDFMLALSLQNEGQASSVAEQDFWRAVCEADQSHGGPRSLSDIKGAADEIMLPCEFCEELY
  PEELLIDHQTSCNPSRALPSLNTGSSSPRGVEEPDVIFQNFLQQAASNQLDSLMGLSNSHPVEESIIIPCEFCGV
  QLEEEVLFHHQDQCDQRPATATNHVTEGIPRLDSQPQETSPELPRRRVRHQGDLSSGYLDDTKQETANGPTSCLP
  PSRPINNMTATYNQLSRSTSGPRPGCQPSSPCVPKLSNSDSQDIQGRNRDSQNGAIAPGHVSVIRPPQNLYPENI
  VPSFSPGPSGRYGASGRSEGGRNSRVTPAAANYRSRTAKAKPSKQQGAGDAEEEEEE

• Structural information:
  • Interpro: IPR013083  
  • PDB: 2D9K
  • PDBsum: 2D9K
  • STRING: ENSP00000257604
• Other Databases: GeneCards:  TRAFD1  Malacards:  TRAFD1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007005	mitochondrion organization	IBA	biological process
GO:0005739	mitochondrion	IBA	cellular component
GO:0045824	negative regulation of innate immune response	ISS	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045824	negative regulation of innate immune response	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881