Search Result
| Gene id | 1087 | ||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary SNPs Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||
| Gene Symbol | CEACAM7 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||
| Aliases | CGM2 | ||||||||||||||||||||||||||||||||||||
| Gene name | CEA cell adhesion molecule 7 | ||||||||||||||||||||||||||||||||||||
| Alternate names | carcinoembryonic antigen-related cell adhesion molecule 7, carcinoembryonic antigen CGM2, carcinoembryonic antigen gene family member 2, carcinoembryonic antigen related cell adhesion molecule 7, | ||||||||||||||||||||||||||||||||||||
| Gene location |
19q13.2 (41688269: 41673302) Exons: 5 NC_000019.10 |
||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
This gene encodes a cell surface glycoprotein and member of the carcinoembryonic antigen (CEA) family of proteins. Expression of this gene may be downregulated in colon and rectal cancer. Additionally, lower expression levels of this gene may be predictiv |
||||||||||||||||||||||||||||||||||||
SNPs |
rs222859 Strand: Allele origin: Allele change: Mutation type: snv NC_000017.11 g.7294475C>A NC_000017.10 g.7197794C>A NM_015982.4 c.26G>T NM_015982.3 c.26G>T XM_017024713.2 c.26G>T NP_057066.2 p.Gly9Val XP_016880202.1 p.Gly9Val|SEQ=[C/A]|GENE=YBX2 rs605059 Strand: Allele origin: Allele change: Mutation type: snv NC_000017.11 g.42554888G>A NC_000017.11 g.42554888G>C NC_000017.11 g.42554888G>T NC_000017.10 g.40706906G>A NC_000017.10 g.40706906G>C NC_000017.10 g.40706906G>T NM_000413.3 c.937G>A NM_000413.3 c.937G>C NM_000413.3 c.937G>T NM_000413.4 c.937G>A NM_0 |
||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||
| Protein general information | Q14002 Name: Carcinoembryonic antigen related cell adhesion molecule 7 (Carcinoembryonic antigen CGM2) Length: 265 Mass: 29379 Tissue specificity: Expressed in columnar epithelial cells of the colon (at protein level) (PubMed | ||||||||||||||||||||||||||||||||||||
| Sequence |
MGSPSACPYRVCIPWQGLLLTASLLTFWNLPNSAQTNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKGERVHA NYRIIGYVKNISQENAPGPAHNGRETIYPNGTLLIQNVTHNDAGFYTLHVIKENLVNEEVTRQFYVFSEPPKPSI TSNNFNPVENKDIVVLTCQPETQNTTYLWWVNNQSLLVSPRLLLSTDNRTLVLLSATKNDIGPYECEIQNPVGAS RSDPVTLNVRYESVQASSPDLSAGTAVSIMIGVLAGMALI | ||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: CEACAM7  Malacards: CEACAM7 | ||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||