Search Result
| Gene id | 10867 | ||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Gene Summary Protein Summary Gene ontology Diseases PubMed | |||||||||||||||||||||||||||||||||||||||||||||||||
Gene Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||
| Gene Symbol | TSPAN9 Gene UCSC Ensembl | ||||||||||||||||||||||||||||||||||||||||||||||||
| Aliases | NET-5, NET5, PP1057 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Gene name | tetraspanin 9 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Alternate names | tetraspanin-9, new EST tetraspan 5, tetraspan NET-5, transmembrane 4 superfamily member tetraspan NET-5, tspan-9, | ||||||||||||||||||||||||||||||||||||||||||||||||
| Gene location |
12p13.33-p13.32 (3077354: 3286563) Exons: 12 NC_000012.12 |
||||||||||||||||||||||||||||||||||||||||||||||||
| Gene summary(Entrez) |
The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate |
||||||||||||||||||||||||||||||||||||||||||||||||
| OMIM | 613137 | ||||||||||||||||||||||||||||||||||||||||||||||||
Protein Summary |
|||||||||||||||||||||||||||||||||||||||||||||||||
| Protein general information | O75954 Name: Tetraspanin 9 (Tspan 9) (Tetraspan NET 5) Length: 239 Mass: 26779 Tissue specificity: Expressed in megakaryocytes and platelets (at protein level). {ECO | ||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence |
MARGCLCCLKYMMFLFNLIFWLCGCGLLGVGIWLSVSQGNFATFSPSFPSLSAANLVIAIGTIVMVTGFLGCLGA IKENKCLLLSFFIVLLVILLAELILLILFFVYMDKVNENAKKDLKEGLLLYHTENNVGLKNAWNIIQAEMRCCGV TDYTDWYPVLGENTVPDRCCMENSQGCGRNATTPLWRTGCYEKVKMWFDDNKHVLGTVGMCILIMQILGMAFSMT LFQHIHRTGKKYDA | ||||||||||||||||||||||||||||||||||||||||||||||||
| Structural information |
| ||||||||||||||||||||||||||||||||||||||||||||||||
| Other Databases | GeneCards: TSPAN9  Malacards: TSPAN9 | ||||||||||||||||||||||||||||||||||||||||||||||||
Gene ontology
|
|||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||
Diseases
Expand All | Collapse All |
|||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||
PubMed references
|
|||||||||||||||||||||||||||||||||||||||||||||||||
| |||||||||||||||||||||||||||||||||||||||||||||||||