• Gene id: 10864

Gene Summary

• Gene Symbol: SLC22A7   Gene   UCSC   Ensembl
• Aliases: NLT, OAT2, hOAT11
• Gene name: solute carrier family 22 member 7
• Alternate names: solute carrier family 22 member 7, hOAT2, liver-specific transporter, novel liver transporter, organic anion transporter 11, organic anion transporter 2, solute carrier family 22 (organic anion transporter), member 7,
• Gene location: 6p21.1 (43295709: 43305537)     Exons: 21     NC_000006.12
• Gene summary(Entrez): The protein encoded by this gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and appears to be localized to the basolateral membr
• OMIM: 604995

Protein Summary

• Protein general information: Q9Y694  
  • Name: Solute carrier family 22 member 7 (Novel liver transporter) (Organic anion transporter 2) (hOAT2)
  • Length: 548  
  • Mass: 60026
  • Tissue specificity: Expressed in liver and kidney. {ECO
• Sequence:

  MGFEELLEQVGGFGPFQLRNVALLALPRVLLPLHFLLPIFLAAVPAHRCALPGAPANFSHQDVWLEAHLPREPDG
  TLSSCLRFAYPQALPNTTLGEERQSRGELEDEPATVPCSQGWEYDHSEFSSTIATESQWDLVCEQKGLNRAASTF
  FFAGVLVGAVAFGYLSDRFGRRRLLLVAYVSTLVLGLASAASVSYVMFAITRTLTGSALAGFTIIVMPLELEWLD
  VEHRTVAGVLSSTFWTGGVMLLALVGYLIRDWRWLLLAVTLPCAPGILSLWWVPESARWLLTQGHVKEAHRYLLH
  CARLNGRPVCEDSFSQEAVSKVAAGERVVRRPSYLDLFRTPRLRHISLCCVVVWFGVNFSYYGLSLDVSGLGLNV
  YQTQLLFGAVELPSKLLVYLSVRYAGRRLTQAGTLLGTALAFGTRLLVSSDMKSWSTVLAVMGKAFSEAAFTTAY
  LFTSELYPTVLRQTGMGLTALVGRLGGSLAPLAALLDGVWLSLPKLTYGGIALLAAGTALLLPETRQAQLPETIQ
  DVERKSAPTSLQEEEMPMKQVQN

• Structural information:
  • Interpro: IPR011701  IPR020846  IPR036259  IPR004749  
  • Prosite: PS50850
  • STRING: ENSP00000361666
• Other Databases: GeneCards:  SLC22A7  Malacards:  SLC22A7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070731	cGMP transport	IDA	biological process
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0015347	sodium-independent organic anion transmembrane transporter activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0015711	organic anion transport	TAS	biological process
GO:0016020	membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0008514	organic anion transmembrane transporter activity	IEA	molecular function
GO:0015711	organic anion transport	IEA	biological process
GO:0016323	basolateral plasma membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04976	Bile secretion

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)