• Gene id: 10758

Gene Summary

• Gene Symbol: TRAF3IP2   Gene   UCSC   Ensembl
• Aliases: ACT1, C6orf2, C6orf4, C6orf5, C6orf6, CANDF8, CIKS, PSORS13
• Gene name: TRAF3 interacting protein 2
• Alternate names: adapter protein CIKS, NFkB-activating protein ACT1, connection to IKK and SAPK/JNK, nuclear factor NF-kappa-B activator 1, symbol withdrawn, see C6orf4,
• Gene location: 6q21 (111606273: 111555377)     Exons: 11     NC_000006.12
• Gene summary(Entrez): This gene encodes a protein involved in regulating responses to cytokines by members of the Rel/NF-kappaB transcription factor family. These factors play a central role in innate immunity in response to pathogens, inflammatory signals and stress. This gen
• OMIM: 607043

Protein Summary

• Protein general information: O43734  
  • Name: Adapter protein CIKS (Connection to IKK and SAPK/JNK) (Nuclear factor NF kappa B activator 1) (ACT1) (TRAF3 interacting protein 2)
  • Length: 574  
  • Mass: 64666
  • Tissue specificity: Widely expressed.
• Sequence:

  MPPQLQETRMNRSIPVEVDESEPYPSQLLKPIPEYSPEEESEPPAPNIRNMAPNSLSAPTMLHNSSGDFSQAHST
  LKLANHQRPVSRQVTCLRTQVLEDSEDSFCRRHPGLGKAFPSGCSAVSEPASESVVGALPAEHQFSFMEKRNQWL
  VSQLSAASPDTGHDSDKSDQSLPNASADSLGGSQEMVQRPQPHRNRAGLDLPTIDTGYDSQPQDVLGIRQLERPL
  PLTSVCYPQDLPRPLRSREFPQFEPQRYPACAQMLPPNLSPHAPWNYHYHCPGSPDHQVPYGHDYPRAAYQQVIQ
  PALPGQPLPGASVRGLHPVQKVILNYPSPWDHEERPAQRDCSFPGLPRHQDQPHHQPPNRAGAPGESLECPAELR
  PQVPQPPSPAAVPRPPSNPPARGTLKTSNLPEELRKVFITYSMDTAMEVVKFVNFLLVNGFQTAIDIFEDRIRGI
  DIIKWMERYLRDKTVMIIVAISPKYKQDVEGAESQLDEDEHGLHTKYIHRMMQIEFIKQGSMNFRFIPVLFPNAK
  KEHVPTWLQNTHVYSWPKNKKNILLRLLREEEYVAPPRGPLPTLQVVPL

• Structural information:
  • Protein Domains: (409..55-)
    (/note="SEFIR-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00867"-)
  • Interpro: IPR013568  
  • Prosite: PS51534
  • STRING: ENSP00000357750
• Other Databases: GeneCards:  TRAF3IP2  Malacards:  TRAF3IP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002230	positive regulation of defense response to virus by host	IDA	biological process
GO:0006959	humoral immune response	IBA	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IBA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0048305	immunoglobulin secretion	IEA	biological process
GO:0006959	humoral immune response	IEA	biological process
GO:0001783	B cell apoptotic process	IEA	biological process
GO:0005102	signaling receptor binding	IEA	molecular function
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IEP	biological process
GO:0035556	intracellular signal transduction	NAS	biological process
GO:0005575	cellular_component	ND	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04218	Cellular senescence
hsa04657	IL-17 signaling pathway

Diseases

Associated diseases	References
Psoriasis	KEGG:H01656
Psoriasis	KEGG:H01656
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881