• Gene id: 10753

Gene Summary

• Gene Symbol: CAPN9   Gene   UCSC   Ensembl
• Aliases: GC36, nCL-4
• Gene name: calpain 9
• Alternate names: calpain-9, digestive tract-specific calpain, new calpain 4, novel calpain large subunit-4,
• Gene location: 1q42.2 (230747288: 230803355)     Exons: 23     NC_000001.11
• Gene summary(Entrez): Calpains are ubiquitous, well-conserved family of calcium-dependent, cysteine proteases. The calpain proteins are heterodimers consisting of an invariant small subunit and variable large subunits. The large subunit possesses a cysteine protease domain, an
• OMIM: 602244

Protein Summary

• Protein general information: O14815  
  • Name: Calpain 9 (EC 3.4.22. ) (Digestive tract specific calpain) (New calpain 4) (nCL 4) (Protein CG36)
  • Length: 690  
  • Mass: 79097
  • Tissue specificity: Expressed predominantly in stomach.
• Sequence:

  MPYLYRAPGPQAHPVPKDARITHSSGQSFEQMRQECLQRGTLFEDADFPASNSSLFYSERPQIPFVWKRPGEIVK
  NPEFILGGATRTDICQGELGDCWLLAAIASLTLNQKALARVIPQDQSFGPGYAGIFHFQFWQHSEWLDVVIDDRL
  PTFRDRLVFLHSADHNEFWSALLEKAYAKLNGSYEALKGGSAIEAMEDFTGGVAETFQTKEAPENFYEILEKALK
  RGSLLGCFIDTRSAAESEARTPFGLIKGHAYSVTGIDQVSFRGQRIELIRIRNPWGQVEWNGSWSDSSPEWRSVG
  PAEQKRLCHTALDDGEFWMAFKDFKAHFDKVEICNLTPDALEEDAIHKWEVTVHQGSWVRGSTAGGCRNFLDTFW
  TNPQIKLSLTEKDEGQEECSFLVALMQKDRRKLKRFGANVLTIGYAIYECPDKDEHLNKDFFRYHASRARSKTFI
  NLREVSDRFKLPPGEYILIPSTFEPHQEADFCLRIFSEKKAITRDMDGNVDIDLPEPPKPTPPDQETEEEQRFRA
  LFEQVAGEDMEVTAEELEYVLNAVLQKKKDIKFKKLSLISCKNIISLMDTSGNGKLEFDEFKVFWDKLKQWINLF
  LRFDADKSGTMSTYELRTALKAAGFQLSSHLLQLIVLRYADEELQLDFDDFLNCLVRLENASRVFQALSTKNKEF
  IHLNINEFIHLTMNI

• Structural information:
  • Protein Domains: (42..33-)
    (/note="Calpain-catalytic)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00239-)
    (518..55-)
    (/note="EF-hand-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448-)
    (561..59-)
    (/note="EF-hand-2)
    (/evidence="ECO:0000255|PROSITE-Pro-)
  • Interpro: IPR033883  IPR022684  IPR022682  IPR022683  IPR036213   IPR029531  IPR011992  IPR018247  IPR002048  IPR038765  IPR000169  IPR001300  
  • Prosite: PS50203 PS00018 PS50222 PS00139
  • CDD: cd00214 cd00044
  • PDB: 1ZIV 2P0R
  • PDBsum: 1ZIV 2P0R
  • STRING: ENSP00000271971
• Other Databases: GeneCards:  CAPN9  Malacards:  CAPN9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004198	calcium-dependent cysteine-type endopeptidase activity	IBA	NOT|molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0006508	proteolysis	IBA	NOT|biological process
GO:0006508	proteolysis	IBA	biological process
GO:0005509	calcium ion binding	IEA	molecular function
GO:0045214	sarcomere organization	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005509	calcium ion binding	TAS	molecular function
GO:0004198	calcium-dependent cysteine-type endopeptidase activity	TAS	molecular function
GO:0007586	digestion	TAS	biological process
GO:0005575	cellular_component	ND	cellular component

Diseases

Associated diseases	References
Stomach cancer	PMID:10835488
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881