• Gene id: 10693

Gene Summary

• Gene Symbol: CCT6B   Gene   UCSC   Ensembl
• Aliases: CCT-zeta-2, CCTZ-2, Cctz2, TCP-1-zeta-2, TSA303
• Gene name: chaperonin containing TCP1 subunit 6B
• Alternate names: T-complex protein 1 subunit zeta-2, chaperonin containing TCP1, subunit 6B (zeta 2), chaperonin-containing T-complex polypeptide 1, subunit 6B, testis-specific Tcp20, testis-specific protein TSA303,
• Gene location: 17q12 (34981221: 34927860)     Exons: 15     NC_000017.11
• Gene summary(Entrez): This gene encodes a molecular chaperone that is a member of the chaperonin-containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded
• OMIM: 610730

Protein Summary

• Protein general information: Q92526  
  • Name: T complex protein 1 subunit zeta 2 (TCP 1 zeta 2) (CCT zeta 2) (CCT zeta like) (TCP 1 zeta like) (Testis specific Tcp20) (Testis specific protein TSA303)
  • Length: 530  
  • Mass: 57821
  • Tissue specificity: Testis-specific. {ECO
• Sequence:

  MAAIKAVNSKAEVARARAALAVNICAARGLQDVLRTNLGPKGTMKMLVSGAGDIKLTKDGNVLLDEMQIQHPTAS
  LIAKVATAQDDVTGDGTTSNVLIIGELLKQADLYISEGLHPRIIAEGFEAAKIKALEVLEEVKVTKEMKRKILLD
  VARTSLQTKVHAELADVLTEVVVDSVLAVRRPGYPIDLFMVEIMEMKHKLGTDTKLIQGLVLDHGARHPDMKKRV
  EDAFILICNVSLEYEKTEVNSGFFYKTAEEKEKLVKAERKFIEDRVQKIIDLKDKVCAQSNKGFVVINQKGIDPF
  SLDSLAKHGIVALRRAKRRNMERLSLACGGMAVNSFEDLTVDCLGHAGLVYEYTLGEEKFTFIEECVNPCSVTLL
  VKGPNKHTLTQVKDAIRDGLRAIKNAIEDGCMVPGAGAIEVAMAEALVTYKNSIKGRARLGVQAFADALLIIPKV
  LAQNAGYDPQETLVKVQAEHVESKQLVGVDLNTGEPMVAADAGVWDNYCVKKQLLHSCTVIATNILLVDEIMRAG
  MSSLK

• Structural information:
  • Interpro: IPR012722  IPR017998  IPR002194  IPR002423  IPR027409   IPR027413  IPR027410  
  • Prosite: PS00750 PS00751 PS00995
  • CDD: cd03342
  • DIP: 53269
  • STRING: ENSP00000327191
• Other Databases: GeneCards:  CCT6B  Malacards:  CCT6B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005832	chaperonin-containing T-complex	IBA	cellular component
GO:0006457	protein folding	IEA	biological process
GO:0051082	unfolded protein binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005832	chaperonin-containing T-complex	IEA	cellular component
GO:1901998	toxin transport	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R