• Gene id: 10666

Gene Summary

• Gene Symbol: CD226   Gene   UCSC   Ensembl
• Aliases: DNAM-1, DNAM1, PTA1, TLiSA1
• Gene name: CD226 molecule
• Alternate names: CD226 antigen, DNAX accessory molecule-1, T lineage-specific activation antigen 1 antigen, adhesion glycoprotein, platelet and T cell activation antigen 1,
• Gene location: 18q22.2 (28180794: 27830572)     Exons: 6     NC_000007.14
• Gene summary(Entrez): This gene encodes a glycoprotein expressed on the surface of NK cells, platelets, monocytes and a subset of T cells. It is a member of the Ig-superfamily containing 2 Ig-like domains of the V-set. The protein mediates cellular adhesion of platelets and me
• OMIM: 605397

Protein Summary

• Protein general information: Q15762  
  • Name: CD226 antigen (DNAX accessory molecule 1) (DNAM 1) (CD antigen CD226)
  • Length: 336  
  • Mass: 38614
  • Tissue specificity: Expressed by peripheral blood T-lymphocytes. {ECO
• Sequence:

  MDYPTLLLALLHVYRALCEEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSIAIFSPTHGMVIRKPY
  AERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQKVIQVVQSDSFEAAVPSNSHIVSEPGKNVTL
  TCQPQMTWPVQAVRWEKIQPRQIDLLTYCNLVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSGLYRCYLQ
  ASAGENETFVMRLTVAEGKTDNQYTLFVAGGTVLLLLFVISITTIIVIFLNRRRRRERRDLFTESWDTQKAPNNY
  RSPISTSQPTNQSMDDTREDIYVNYPTFSRRPKTRV

• Structural information:
  • Protein Domains: (19..12-)
    1 (/note="Ig-like-C2-type)
    (135..23-)
    2" (/note="Ig-like-C2-type)
  • Interpro: IPR042842  IPR007110  IPR036179  IPR013783  IPR003599   IPR003598  IPR013106  
  • Prosite: PS50835
  • PDB: 6ISB 6O3O
  • PDBsum: 6ISB 6O3O
  • STRING: ENSP00000280200
• Other Databases: GeneCards:  CD226  Malacards:  CD226

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0060369	positive regulation of Fc receptor mediated stimulatory signaling pathway	IBA	biological process
GO:0050862	positive regulation of T cell receptor signaling pathway	IBA	biological process
GO:0002891	positive regulation of immunoglobulin mediated immune response	IBA	biological process
GO:0002729	positive regulation of natural killer cell cytokine production	IBA	biological process
GO:0033005	positive regulation of mast cell activation	IBA	biological process
GO:0032729	positive regulation of interferon-gamma production	IBA	biological process
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0002860	positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target	IBA	biological process
GO:0001816	cytokine production	IBA	biological process
GO:0002729	positive regulation of natural killer cell cytokine production	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007155	cell adhesion	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0050776	regulation of immune response	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0002729	positive regulation of natural killer cell cytokine production	IEA	biological process
GO:0032729	positive regulation of interferon-gamma production	IEA	biological process
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0001816	cytokine production	IEA	biological process
GO:0005178	integrin binding	IPI	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0050839	cell adhesion molecule binding	IPI	molecular function
GO:0050839	cell adhesion molecule binding	IPI	molecular function
GO:0002891	positive regulation of immunoglobulin mediated immune response	IDA	biological process
GO:0060369	positive regulation of Fc receptor mediated stimulatory signaling pathway	IDA	biological process
GO:0045121	membrane raft	TAS	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0033005	positive regulation of mast cell activation	IDA	biological process
GO:0002860	positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target	IMP	biological process
GO:0008037	cell recognition	TAS	biological process
GO:0045954	positive regulation of natural killer cell mediated cytotoxicity	IMP	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0050862	positive regulation of T cell receptor signaling pathway	IMP	biological process
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04514	Cell adhesion molecules

Diseases

Associated diseases	References
Type 1 diabetes mellitus	KEGG:H00408
Type 1 diabetes mellitus	KEGG:H00408
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq