• Gene id: 10644

Gene Summary

• Gene Symbol: IGF2BP2   Gene   UCSC   Ensembl
• Aliases: IMP-2, IMP2, VICKZ2
• Gene name: insulin like growth factor 2 mRNA binding protein 2
• Alternate names: insulin-like growth factor 2 mRNA-binding protein 2, IGF-II mRNA-binding protein 2, IGF2 mRNA-binding protein 2, VICKZ family member 2,
• Gene location: 3q27.2 (22244785: 22245514)     Exons: 2     NC_000022.11
• Gene summary(Entrez): This gene encodes a protein that binds the 5' UTR of insulin-like growth factor 2 (IGF2) mRNA and regulates its translation. It plays an important role in metabolism and variation in this gene is associated with susceptibility to diabetes. Alternative spl
• OMIM: 608289

Protein Summary

• Protein general information: Q9Y6M1  
  • Name: Insulin like growth factor 2 mRNA binding protein 2 (IGF2 mRNA binding protein 2) (IMP 2) (Hepatocellular carcinoma autoantigen p62) (IGF II mRNA binding protein 2) (VICKZ family member 2)
  • Length: 599  
  • Mass: 66121
  • Tissue specificity: Expressed in oocytes, granulosa cells of small and growing follicles, Leydig cells, spermatogonia and semen (at protein level). Expressed in testicular cancer (at protein level). Expressed weakly in heart, placenta, skeletal muscle, bo
• Sequence:

  MMNKLYIGNLSPAVTADDLRQLFGDRKLPLAGQVLLKSGYAFVDYPDQNWAIRAIETLSGKVELHGKIMEVDYSV
  SKKLRSRKIQIRNIPPHLQWEVLDGLLAQYGTVENVEQVNTDTETAVVNVTYATREEAKIAMEKLSGHQFENYSF
  KISYIPDEEVSSPSPPQRAQRGDHSSREQGHAPGGTSQARQIDFPLRILVPTQFVGAIIGKEGLTIKNITKQTQS
  RVDIHRKENSGAAEKPVTIHATPEGTSEACRMILEIMQKEADETKLAEEIPLKILAHNGLVGRLIGKEGRNLKKI
  EHETGTKITISSLQDLSIYNPERTITVKGTVEACASAEIEIMKKLREAFENDMLAVNQQANLIPGLNLSALGIFS
  TGLSVLSPPAGPRGAPPAAPYHPFTTHSGYFSSLYPHHQFGPFPHHHSYPEQEIVNLFIPTQAVGAIIGKKGAHI
  KQLARFAGASIKIAPAEGPDVSERMVIITGPPEAQFKAQGRIFGKLKEENFFNPKEEVKLEAHIRVPSSTAGRVI
  GKGGKTVNELQNLTSAEVIVPRDQTPDENEEVIVRIIGHFFASQTAQRKIREIVQQVKQQEQKYPQGVASQRSK

• Structural information:
  • Protein Domains: (3..7-)
    (/note="RRM-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (82..15-)
    (/note="RRM-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (193..25-)
    (/note="KH-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00117-)
    (2-)
  • Interpro: IPR028743  IPR034843  IPR004087  IPR004088  IPR036612   IPR012677  IPR035979  IPR000504  
  • Prosite: PS50084 PS50102
  • CDD: cd12626
  • PDB: 2CQH 6ROL
  • PDBsum: 2CQH 6ROL
  • DIP: 35539
  • STRING: ENSP00000371634
• Other Databases: GeneCards:  IGF2BP2  Malacards:  IGF2BP2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	IBA	cellular component
GO:0003729	mRNA binding	IBA	molecular function
GO:0010468	regulation of gene expression	IBA	biological process
GO:0007399	nervous system development	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0003730	mRNA 3'-UTR binding	IBA	molecular function
GO:0003730	mRNA 3'-UTR binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003729	mRNA binding	IEA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0051028	mRNA transport	IEA	biological process
GO:0006417	regulation of translation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0009653	anatomical structure morphogenesis	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0043488	regulation of mRNA stability	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0048027	mRNA 5'-UTR binding	IDA	molecular function
GO:0045182	translation regulator activity	ISS	molecular function
GO:0042035	regulation of cytokine biosynthetic process	IC	biological process
GO:0017148	negative regulation of translation	ISS	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005856	cytoskeleton	IDA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Type 2 diabetes mellitus	KEGG:H00409
Type 2 diabetes mellitus	KEGG:H00409
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq