• Gene id: 10633

Gene Summary

• Gene Symbol: RASL10A   Gene   UCSC   Ensembl
• Aliases: RRP22
• Gene name: RAS like family 10 member A
• Alternate names: ras-like protein family member 10A, ras-like protein RRP22, ras-related protein on chromosome 22,
• Gene location: 22q12.2 (29319617: 29312932)     Exons: 6     NC_000022.11
• OMIM: 601617

Protein Summary

• Protein general information: Q92737  
  • Name: Ras like protein family member 10A (Ras like protein RRP22) (Ras related protein on chromosome 22)
  • Length: 203  
  • Mass: 22541
  • Tissue specificity: Expression appears to be strictly limited to the central nervous system. {ECO
• Sequence:

  MGGSLRVAVLGAPGVGKTAIIRQFLFGDYPERHRPTDGPRLYRPAVLLDGAVYDLSIRDGDVAGPGSSPGGPEEW
  PDAKDWSLQDTDAFVLVYDICSPDSFDYVKALRQRIAETRPAGAPEAPILVVGNKRDRQRLRFGPRRALAALVRR
  GWRCGYLECSAKYNWHVLRLFRELLRCALVRARPAHPALRLQGALHPARCSLM

• Structural information:
  • Interpro: IPR027417  IPR001806  IPR020849  
  • Prosite: PS51421
  • STRING: ENSP00000216101
• Other Databases: GeneCards:  RASL10A  Malacards:  RASL10A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005525	GTP binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003924	GTPase activity	TAS	molecular function
GO:0007264	small GTPase mediated signal transduction	TAS	biological process
GO:0005730	nucleolus	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881