• Gene id: 10557

Gene Summary

• Gene Symbol: RPP38   Gene   UCSC   Ensembl
• Gene name: ribonuclease P/MRP subunit p38
• Alternate names: ribonuclease P protein subunit p38, RNaseP protein p38, ribonuclease P/MRP 38kDa subunit,
• Gene location: 10p13 (15097179: 15104256)     Exons: 4     NC_000010.11
• OMIM: 606116

Protein Summary

• Protein general information: P78345  
  • Name: Ribonuclease P protein subunit p38 (RNaseP protein p38) (EC 3.1.26.5)
  • Length: 283  
  • Mass: 31834
• Sequence:

  MAAAPQAPGRGSLRKTRPLVVKTSLNNPYIIRWSALESEDMHFILQTLEDRLKAIGLQKIEDKKKKNKTPFLKKE
  SREKCSIAVDISENLKEKKTDAKQQVSGWTPAHVRKQLAIGVNEVTRALERRELLLVLVCKSVKPAMITSHLIQL
  SLSRSVPACQVPRLSERIAPVIGLKCVLALAFKKNTTDFVDEVRAIIPRVPSLSVPWLQDRIEDSGENLETEPLE
  SQDRELLDTSFEDLSKPKRKLADGRQASVTLQPLKIKKLIPNPNKIRKPPKSKKATPK

• Structural information:
  • Interpro: IPR029064  IPR004038  IPR042848  
  • PDB: 6AHR 6AHU
  • PDBsum: 6AHR 6AHU
  • STRING: ENSP00000478982
• Other Databases: GeneCards:  RPP38  Malacards:  RPP38

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0033204	ribonuclease P RNA binding	IBA	molecular function
GO:0030681	multimeric ribonuclease P complex	IBA	cellular component
GO:0001682	tRNA 5'-leader removal	IBA	biological process
GO:0004526	ribonuclease P activity	IBA	contributes to
GO:0001650	fibrillar center	IBA	cellular component
GO:0033204	ribonuclease P RNA binding	IDA	molecular function
GO:0030681	multimeric ribonuclease P complex	IDA	cellular component
GO:0001682	tRNA 5'-leader removal	IDA	biological process
GO:0005730	nucleolus	IDA	cellular component
GO:0004526	ribonuclease P activity	IDA	contributes to
GO:0001682	tRNA 5'-leader removal	IEA	biological process
GO:0008033	tRNA processing	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006364	rRNA processing	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0004526	ribonuclease P activity	IEA	molecular function
GO:0001682	tRNA 5'-leader removal	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0001650	fibrillar center	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0090502	RNA phosphodiester bond hydrolysis, endonucleolytic	IEA	biological process
GO:0090502	RNA phosphodiester bond hydrolysis, endonucleolytic	IEA	biological process
GO:0090502	RNA phosphodiester bond hydrolysis, endonucleolytic	IEA	biological process
GO:0090501	RNA phosphodiester bond hydrolysis	IEA	biological process
GO:0090501	RNA phosphodiester bond hydrolysis	IEA	biological process
GO:0090501	RNA phosphodiester bond hydrolysis	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa03013	RNA transport
hsa03008	Ribosome biogenesis in eukaryotes

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R