• Gene id: 10534

Gene Summary

• Gene Symbol: ZNRD2   Gene   UCSC   Ensembl
• Aliases: SSSCA1, p27
• Gene name: zinc ribbon domain containing 2
• Alternate names: protein ZNRD2, Sjogren syndrome/scleroderma autoantigen 1, Sjogren's syndrome/scleroderma autoantigen 1, autoantigen p27, centromeric autoantigen (27kD), sjoegren syndrome/scleroderma autoantigen 1, zinc ribbon domain-containing protein 2,
• Gene location: 11q13.1 (65570458: 65571887)     Exons: 3     NC_000011.10
• Gene summary(Entrez): This antigen is recognized by a subset of anti-centromere antibodies from patients with scleroderma and/or Sjogren's syndrome. Subcellular localization has not yet been established. [provided by RefSeq, Jul 2008]

Protein Summary

• Protein general information: O60232  
  • Name: Protein ZNRD2 (Autoantigen p27) (Sjoegren syndrome/scleroderma autoantigen 1) (Zinc ribbon domain containing protein 2)
  • Length: 199  
  • Mass: 21474
• Sequence:

  MALNGAEVDDFSWEPPTEAETKVLQARRERQDRISRLMGDYLLRGYRMLGETCADCGTILLQDKQRKIYCVACQE
  LDSDVDKDNPALNAQAALSQAREHQLASASELPLGSRPAPQPPVPRPEHCEGAAAGLKAAQGPPAPAVPPNTDVM
  ACTQTALLQKLTWASAELGSSTSLETSIQLCGLIRACAEALRSLQQLQH

• Structural information:
  • Interpro: IPR009563  
  • STRING: ENSP00000312318
• Other Databases: GeneCards:  ZNRD2  Malacards:  ZNRD2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051301	cell division	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0000278	mitotic cell cycle	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881