• Gene id: 10527

Gene Summary

• Gene Symbol: IPO7   Gene   UCSC   Ensembl
• Aliases: Imp7, RANBP7
• Gene name: importin 7
• Alternate names: importin-7, RAN-binding protein 7,
• Gene location: 11p15.4 (9384651: 9448126)     Exons: 25     NC_000011.10
• Gene summary(Entrez): The importin-alpha/beta complex and the GTPase Ran mediate nuclear import of proteins with a classical nuclear localization signal. The protein encoded by this gene is a member of a class of approximately 20 potential Ran targets that share a sequence mot
• OMIM: 605586

Protein Summary

• Protein general information: O95373  
  • Name: Importin 7 (Imp7) (Ran binding protein 7) (RanBP7)
  • Length: 1038  
  • Mass: 119517
• Sequence:

  MDPNTIIEALRGTMDPALREAAERQLNEAHKSLNFVSTLLQITMSEQLDLPVRQAGVIYLKNMITQYWPDRETAP
  GDISPYTIPEEDRHCIRENIVEAIIHSPELIRVQLTTCIHHIIKHDYPSRWTAIVDKIGFYLQSDNSACWLGILL
  CLYQLVKNYEYKKPEERSPLVAAMQHFLPVLKDRFIQLLSDQSDQSVLIQKQIFKIFYALVQYTLPLELINQQNL
  TEWIEILKTVVNRDVPNETLQVEEDDRPELPWWKCKKWALHILARLFERYGSPGNVSKEYNEFAEVFLKAFAVGV
  QQVLLKVLYQYKEKQYMAPRVLQQTLNYINQGVSHALTWKNLKPHIQGIIQDVIFPLMCYTDADEELWQEDPYEY
  IRMKFDVFEDFISPTTAAQTLLFTACSKRKEVLQKTMGFCYQILTEPNADPRKKDGALHMIGSLAEILLKKKIYK
  DQMEYMLQNHVFPLFSSELGYMRARACWVLHYFCEVKFKSDQNLQTALELTRRCLIDDREMPVKVEAAIALQVLI
  SNQEKAKEYITPFIRPVMQALLHIIRETENDDLTNVIQKMICEYSEEVTPIAVEMTQHLAMTFNQVIQTGPDEEG
  SDDKAVTAMGILNTIDTLLSVVEDHKEITQQLEGICLQVIGTVLQQHVLEFYEEIFSLAHSLTCQQVSPQMWQLL
  PLVFEVFQQDGFDYFTDMMPLLHNYVTVDTDTLLSDTKYLEMIYSMCKKVLTGVAGEDAECHAAKLLEVIILQCK
  GRGIDQCIPLFVEAALERLTREVKTSELRTMCLQVAIAALYYNPHLLLNTLENLRFPNNVEPVTNHFITQWLNDV
  DCFLGLHDRKMCVLGLCALIDMEQIPQVLNQVSGQILPAFILLFNGLKRAYACHAEHENDSDDDDEAEDDDETEE
  LGSDEDDIDEDGQEYLEILAKQAGEDGDDEDWEEDDAEETALEGYSTIIDDEDNPVDEYQIFKAIFQTIQNRNPV
  WYQALTHGLNEEQRKQLQDIATLADQRRAAHESKMIEKHGGYKFSAPVVPSSFNFGGPAPGMN

• Structural information:
  • Protein Domains: (22..10-)
    (/note="Importin-N-terminal)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00115"-)
  • Interpro: IPR016024  IPR001494  IPR013713  
  • Prosite: PS50166
  • DIP: 32574
  • STRING: ENSP00000369042
• Other Databases: GeneCards:  IPO7  Malacards:  IPO7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045736	negative regulation of cyclin-dependent protein serine/threonine kinase activity	TAS	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0005635	nuclear envelope	IBA	cellular component
GO:0006606	protein import into nucleus	IBA	biological process
GO:0046332	SMAD binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006886	intracellular protein transport	IEA	biological process
GO:0008536	Ran GTPase binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0030695	GTPase regulator activity	TAS	molecular function
GO:0008536	Ran GTPase binding	TAS	molecular function
GO:0005215	transporter activity	TAS	molecular function
GO:0005643	nuclear pore	TAS	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0006606	protein import into nucleus	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0042393	histone binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq